KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_00015Help
Entry
KPN2242_00015     CDS       T01982                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00620  Pyruvate metabolism
kpo00630  Glyoxylate and dicarboxylate metabolism
kpo01100  Metabolic pathways
kpo01110  Biosynthesis of secondary metabolites
kpo01120  Microbial metabolism in diverse environments
kpo01200  Carbon metabolism
Module
kpo_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPN2242_00015
   00630 Glyoxylate and dicarboxylate metabolism
    KPN2242_00015
Enzymes [BR:kpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KPN2242_00015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AEJ95930
Position
2150..3751
Genome map
AA seq 533 aa AA seqDB search
MTQQATITDELAFSQPYGEQEKQILTPEAVEFLTELVSRFTPARNKLLAARLQQQQAIDD
GQLPDFISETASIRNGDWTIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWRKVIDGQINLRDAVNGTISYTNEAGKIYQLQPNPAVLVCRVRGLHLPEKHVTWR
NEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQAWQEAAWWNDVFSFTEDRFDLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDTERNRQVLSKVTADKELEANNG
HDGTWIAHPGLADTAMAVFDRVLGDKPNQLSVTRSEDAPITAEQLLAPCEGERTEAGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLNDGTPVTKALFR
QWLAEELMVIQEELGEHRFSHGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaggcgacaatcaccgatgaactggcctttagtcagccctatggcgagcag
gagaagcagatcttaacgcctgaggcggtagaatttctgacggaactggtgagccgcttt
acgccggcgcgcaataagctgctggccgcgcgtttgcagcaacagcaggctattgacgac
gggcagcttccggattttatttcggaaactgcttccattagaaatggcgactggactatt
cgcggtatcccggctgatttgcaggatcgccgcgtggaaatcaccggccccgtcgagcgc
aagatggtcattaacgcgctgaatgccaacgtcaaagtctttatggcggactttgaggat
tcgctggcgcctgactggcgcaaagtcattgatggtcaaatcaacctgcgcgatgccgtg
aacggaaccatcagctacaccaacgaggccggcaaaatctatcagttgcagcccaatccc
gctgtgctggtatgccgtgtgcgcggcctgcatctgccggaaaagcatgtgacctggcgt
aatgaggccatccccggcagcctgttcgattttgcgctctatttctttcataactaccag
gcgctgctggcgaaaggaagtggtccctacttctatctgccaaaaacacaggcctggcag
gaggcggcatggtggaacgatgtcttcagttttacggaagatcgctttgacctgccgcgc
ggcaccatcaaggccacgctgctgattgagacgctgccagcggtgttccagatggatgag
atcctgcatgcgctgcgcgaccatattgttggcctgaactgcggccgctgggattacatc
ttcagttatatcaagactctgaaaaaccatccggatcgcgtactgccggaccggcaggtg
gtgacgatggataaacccttcctcagcgcctactcacgcttgttgattaagacctgccac
aaacgcggcgcgtttgcgatgggcggtatggcggcgtttatcccgagcaaagataccgaa
cgtaaccgccaggtgctgagtaaagtcaccgccgataaagagctggaggcaaacaacggt
cacgatgggacctggatcgctcacccgggcctggcggataccgccatggcggtgtttgac
cgcgtgctgggcgataagccgaatcagctctcggtcacccggagcgaggatgcgccaatt
accgctgaacaactgctggctccctgcgagggcgaacgcacggaagccggaatgcgcgcc
aacattcgcgtggcggtgcagtacatcgaagcgtggatctccggcaacggctgcgtaccg
atttatggcctgatggaagacgccgcaacggccgagatctcgcgcacctctatctggcag
tggatccatcatcagaaaaccctgaacgacggtaccccggtcactaaggcgctgttccgc
cagtggctggcggaagagctgatggtgattcaggaggagctgggagagcaccgcttcagc
cacggccgctttgacgatgcggcgcgactgatggagcagatcaccacctccgacgagcta
attgattttctgacattgccgggctaccgcctgctggcctaa

DBGET integrated database retrieval system