KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_00020Help
Entry
KPN2242_00020     CDS       T01982                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPN2242_00020
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KPN2242_00020
Enzymes [BR:kpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     KPN2242_00020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
3831..5135
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELNKEWTNPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKLWRLLHGE
AKKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPAV
VDRINNTFRRADQIQWSAGIEPNDPRFIDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDADAADL
ITSDCDPYDREFITGDRTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSKPDLEQARR
FAEAIHARFPGKLLAYNCSPSFNWKKNLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMRHYVEKVQQPEFAAGPEGYTFVSHQQEVGTGYFDKVTTIIQGGTS
SVTALTGSTEEDQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacccaacaaatcgaagaattaaacaaagaatggacgaatccgcgctgg
gaaggcattacccgtccctacagcgcggaagaggtggtgaagttacgcggctcggtgaat
ccggaatgcacgctggcgcagcttggcgcggcgaaactgtggcgtctgctgcacggggag
gcgaaaaaagggtacgtcaacagtctcggcgcgctgaccggcggccaggccttgcagcag
gcgaaggcgggtatcgaagccatttatctctccggctggcaggtggcggcggatgctaac
ctggcgtccagcatgtatccggatcaatcactgtatccggccaactcggtaccggcggtg
gtggatcggatcaacaacaccttccgccgcgccgatcagatccagtggtcagcgggaatt
gaaccgaacgatccgcgctttatcgactacttcctgccgatcgtggcggatgcagaggcc
ggttttggcggcgtcctgaacgcctttgagctgatgaaatcgatgattgaagccggtgca
gcggctgttcacttcgaagatcagctggcatcggtgaagaagtgcggccatatgggcggt
aaagtgctggttccgactcaggaggcgattcagaagctggtggcggcgcgtctggcggcc
gacgtgatgggggtcccgacgctggtcatcgcccgtaccgatgccgacgccgcggattta
attacctcagactgcgatccgtacgatcgtgagtttattaccggggatcgcaccagcgaa
gggttcttccgcacccacgccgggatcgagcaggcgatcagccgcgggctggcctacgcg
ccgtatgcggatctggtgtggtgtgaaacgtcgaaaccggatctcgagcaggcgcgccgc
tttgccgaggctatccatgcgcgtttcccgggcaaactgctggcctataactgctcgccg
tcgtttaactggaagaaaaatctcgatgataaaaccatcgccagcttccagcagcagctg
tcggacatgggatacaaataccagtttattaccctcgcggggatccacagcatgtggttc
aacatgttcgacctcgcccatgcctacgctcagggtgaggggatgcgccactatgttgag
aaagtgcagcagccggaattcgccgccgggccggaaggctacaccttcgtctcgcatcag
caggaggtgggcaccggctacttcgacaaggtcaccaccattatccagggtggcacctcg
tcggtaacggcgctgaccggctcgaccgaagaagatcagttttaa

DBGET integrated database retrieval system