KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_00020Help
Entry
KPN2242_00020     CDS       T01982                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:kpo01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:kpo00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3831..5135
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELNKEWTNPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKLWRLLHGE
AKKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPAV
VDRINNTFRRADQIQWSAGIEPNDPRFIDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDADAADL
ITSDCDPYDREFITGDRTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSKPDLEQARR
FAEAIHARFPGKLLAYNCSPSFNWKKNLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMRHYVEKVQQPEFAAGPEGYTFVSHQQEVGTGYFDKVTTIIQGGTS
SVTALTGSTEEDQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacccaacaaatcgaagaattaaacaaagaatggacgaatccgcgctgg
gaaggcattacccgtccctacagcgcggaagaggtggtgaagttacgcggctcggtgaat
ccggaatgcacgctggcgcagcttggcgcggcgaaactgtggcgtctgctgcacggggag
gcgaaaaaagggtacgtcaacagtctcggcgcgctgaccggcggccaggccttgcagcag
gcgaaggcgggtatcgaagccatttatctctccggctggcaggtggcggcggatgctaac
ctggcgtccagcatgtatccggatcaatcactgtatccggccaactcggtaccggcggtg
gtggatcggatcaacaacaccttccgccgcgccgatcagatccagtggtcagcgggaatt
gaaccgaacgatccgcgctttatcgactacttcctgccgatcgtggcggatgcagaggcc
ggttttggcggcgtcctgaacgcctttgagctgatgaaatcgatgattgaagccggtgca
gcggctgttcacttcgaagatcagctggcatcggtgaagaagtgcggccatatgggcggt
aaagtgctggttccgactcaggaggcgattcagaagctggtggcggcgcgtctggcggcc
gacgtgatgggggtcccgacgctggtcatcgcccgtaccgatgccgacgccgcggattta
attacctcagactgcgatccgtacgatcgtgagtttattaccggggatcgcaccagcgaa
gggttcttccgcacccacgccgggatcgagcaggcgatcagccgcgggctggcctacgcg
ccgtatgcggatctggtgtggtgtgaaacgtcgaaaccggatctcgagcaggcgcgccgc
tttgccgaggctatccatgcgcgtttcccgggcaaactgctggcctataactgctcgccg
tcgtttaactggaagaaaaatctcgatgataaaaccatcgccagcttccagcagcagctg
tcggacatgggatacaaataccagtttattaccctcgcggggatccacagcatgtggttc
aacatgttcgacctcgcccatgcctacgctcagggtgaggggatgcgccactatgttgag
aaagtgcagcagccggaattcgccgccgggccggaaggctacaccttcgtctcgcatcag
caggaggtgggcaccggctacttcgacaaggtcaccaccattatccagggtggcacctcg
tcggtaacggcgctgaccggctcgaccgaagaagatcagttttaa

DBGET integrated database retrieval system