KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_01115Help
Entry
KPN2242_01115     CDS       T01982                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:kpo00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(228635..230644)
Genome map
AA seq 669 aa AA seqDB search
MSHLFYGVAYYDEYMPEDRLAKDIALMRETGINVVRIAESTWSTLEPEEGQYNFYHIDRV
LEAMHEAGIAVIVGTPTYAVPAWLAAKHPDILVTTVAGQQKYGPRQIMDIVNPTFRRYAE
KIIRTLMAHVQHHPAIIGWQLDNETKHYDNIGRYMQEGFVRSLQEKYPDLRQLNRDFGLD
YWSNRIDRWQDFPPVENTINASLACAFSRYQRQQVTEYLAWQAAIVREYAQPHQFVTHNF
DFEWRGYSYGVQPRVDHFAAAQALDIAGVDIYHPSQAHLTGREIAFGGAITRSLKPGQNY
FVLETQAQGFAQWTPFPGQLRLQAFSHIASGAAMVSYWHWHSIHNAFETYWKGLLSHDFS
RNPTWQEATTIGADFARLSPQLAELKAENDVALLISNEAMDALNHFLPGDARGNIYNDIF
RRFHDALYDHNISLDIIHDVNEETSRYRVLIVPGLYAADEGLLTRINDYIARGGRALIGF
KSGFSDENVKVRSSAQPGVLRQSCGVSYSQFTLPEETTVSSCCAEIDCRNDNQAELWMEL
LTPDDGTRTLLRYQHPAWGEYAAATEADYGQGRALYVGFLPQKGLISQLFDVLTADLTLN
SRTSAYRYPLVVKKMRNRAGNNIHFLFNYSGEAMDVVSETLGTALLSGETVYVGQPLRLR
AWEFTIIES
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatttattttatggcgtggcgtattacgatgaatatatgccggaagatcggctg
gctaaggatatcgccttaatgcgcgaaaccggcattaacgtggtgcgtattgccgagtcc
acctggagtacgctggagcctgaagagggccagtataatttctaccatatcgaccgggtg
ctggaggcgatgcatgaggccggcattgcggtcatcgtcgggacgccgacctacgcggtc
ccggcctggctggcggcgaaacatcccgatattctggtcaccaccgtcgcggggcagcaa
aaatatggcccgcggcagatcatggatatcgtcaatccgacctttcgccgctatgccgaa
aaaattatccgcacgctgatggcccatgtgcagcaccatccggcgattatcggctggcaa
ctggataacgaaaccaagcattacgacaatattggccgctatatgcaggagggcttcgtg
cgcagcctgcaggagaaatatcctgacctccggcagctgaatcgcgatttcggcctggat
tactggagcaaccgcattgaccgctggcaggattttccgccggtggaaaacaccatcaac
gccagcctcgcctgcgccttctcccgctatcagcgtcagcaggtcaccgagtatctggcc
tggcaggcggccatcgttcgggaatacgcccagccgcaccagttcgtcacccacaacttc
gatttcgaatggcgcggttactcttacggcgtgcagccgcgggtcgaccattttgcggcg
gcgcaggcgctggatatcgccggcgtcgatatctatcacccgagtcaggcacacctgacc
ggacgggaaatcgcctttggcggcgccatcacccgctcgcttaagccgggccagaactac
ttcgtgctggaaacccaggctcagggcttcgcccagtggacccccttcccgggccagcta
cgcctgcaggcattcagccatatcgcctccggcgccgccatggtctcctactggcactgg
cattcgattcataacgcctttgaaacctactggaaggggctgctcagccacgacttctcg
cgcaacccaacctggcaggaagctaccaccatcggcgccgatttcgcccgcctgtcgccg
cagctggcggagctgaaggccgaaaatgacgtcgcgttgctaataagtaatgaggcgatg
gacgctctcaatcacttccttcccggcgacgccaggggcaacatttataacgatatcttc
cgccgcttccacgatgcgctgtatgaccacaatatcagcctcgacatcatccacgatgtg
aacgaggaaacctcgcgctaccgggtgctgatcgttcctggtttgtacgccgccgatgag
ggcctgctaacgcggattaacgactatatcgcccggggcggcagagcgctgatcggcttt
aaatcaggctttagcgatgaaaacgtcaaggtgcgcagcagcgcgcagccgggggttttg
cgccagagctgcggcgtcagctacagccagttcaccctgccggaagagacgacggtaagc
tcttgctgcgcagagattgattgccgcaatgacaatcaggctgagctgtggatggaattg
ctgacgcccgatgacgggacccgcaccctgctgcgctatcagcacccggcatggggcgaa
tacgccgccgcaacggaggcggattacggtcagggtcgcgccctgtacgttggctttctg
ccgcagaagggcctgattagccagctgtttgatgtcctgacggcggatctcacgctgaac
tcgcgaacttccgcctatcgctatccgttagtggttaaaaagatgcgtaaccgcgccgga
aataatatccacttcctgttcaattactccggcgaggcgatggatgttgtcagcgagacc
ctgggtaccgcgctgctgagcggggagacagtatacgtcggccagccgttgcgcctcagg
gcctgggaatttactatcatcgaaagctaa

DBGET integrated database retrieval system