KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_01740Help
Entry
KPN2242_01740     CDS       T01982                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPN2242_01740
   00051 Fructose and mannose metabolism
    KPN2242_01740
Enzymes [BR:kpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     KPN2242_01740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
374575..375894
Genome map
AA seq 439 aa AA seqDB search
MQTYFDQVDRVRFAGPKTDNPLAFRHYNPDEIVLGKRMADHLRFAACYWHNFCWNGADMF
GAGSFERPWQAAGDALEMAKRKADVAFEFFYKLNVPYYCFHDVDVSPEGASLKEYLHNFA
VMTEVLAEKQQQTGVKLLWGTANCFTHPRYGAGAATNPDPEVFAWAATQVVTAMNATHQL
GGENYVLWGGREGYESLLNTDLRQEREQIGRFLQMVVEHKHKIGFGGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLENEIKVNIEANHATLAGHSFHHEIASAIALGIFGSVDANRG
DAQLGWDTDQFPNSVEENTLVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDMFYGHIGAM
DVMALSLKLAARMIEDGKLDQGLAKRYAGWQGELGQKIMSGQMSLDNIARYAEQHNLNPQ
PQSGRQELLENLVNTYIFG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacctatttcgaccaggttgatcgcgttcgctttgccggacccaaaaccgataat
ccgctggcgtttcgccactataatccggatgaaatcgtgctgggaaaacgcatggcagat
catctgcgttttgccgcctgttattggcataacttctgctggaatggcgcggatatgttt
ggcgccggctcgtttgagcgtccctggcaggccgcgggcgatgcgctggaaatggccaaa
cgcaaagcggacgtggcgtttgaatttttctacaagctcaacgtgccgtattactgcttc
catgatgtcgacgtctcgccagaaggcgcgtcgctgaaagagtatttgcataatttcgcc
gtgatgaccgaagtgctggcggagaaacagcagcaaaccggcgtgaaactgctgtggggc
accgccaactgctttacccacccgcgctacggcgccggggcggcgaccaaccccgatccg
gaggtgtttgcctgggcggccacgcaggtggtgaccgccatgaacgccacccaccagctc
ggcggcgaaaactatgtgctgtggggcggccgagaaggttacgagtcgctgttgaatacc
gacctgcgccaggagcgcgagcagattggccgcttcctgcagatggtggtggagcacaag
cataagattggctttggcggcacgctgcttatcgagccgaaaccgcaggagcccaccaag
catcagtacgattacgatgtcgcgacggtgtatggcttcctgaagcagtttggtctggaa
aatgagatcaaggtgaacattgaagccaaccacgccactctggcggggcactctttccac
catgaaatcgccagcgccatcgcgctgggcattttcggctccgttgatgccaaccgcggc
gatgcgcagctcggctgggataccgatcagttcccgaacagcgtggaagaaaataccctg
gtgatgtatgagatcctcaaagccgggggattcaccaccggcggcctgaactttgacgcc
aaagttcgccggcagagcaccgacaaatacgacatgttctatggccatattggcgccatg
gacgtgatggcgctgtccctcaagctggccgcgcgcatgattgaggatggcaagctcgat
cagggtctggcaaaacgctatgccggctggcagggcgagctggggcagaaaattatgagc
gggcaaatgtcgctggataatattgcccgatacgctgagcagcataatctgaatccgcag
cctcagagcgggcgtcaggaattactcgaaaatctcgtcaatacctatatctttggttaa

DBGET integrated database retrieval system