KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_02280Help
Entry
KPN2242_02280     CDS       T01982                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KPN2242_02280
   00240 Pyrimidine metabolism
    KPN2242_02280
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    KPN2242_02280
   03430 Mismatch repair
    KPN2242_02280
   03440 Homologous recombination
    KPN2242_02280
Enzymes [BR:kpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     KPN2242_02280
DNA replication proteins [BR:kpo03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     KPN2242_02280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
484856..485269
Genome map
AA seq 137 aa AA seqDB search
MTSRREWQLQQLGITQWSLRRPGALQGEIAISLPEHIRLVMVAETPPSLTEPLIGDILRA
LAVTPDQVLQLTPERVAMLPQDSRCNSWRLGTEASLPLAGAQVSTPAFDELQTSAPARRA
LWQQICAHEHDFYPQHG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagaatggcaattacagcagctgggcattacccagtggtcgctgcgc
cgaccgggggcgttgcagggcgaaatcgctatctcgcttcctgaacatattcgtctggtg
atggtggcggaaaccccgccgtcgctgacagagccgctgattggcgacatattacgcgcg
ctggccgtgacgccagatcaggtcctgcagctgactccggagcgggtggcgatgctgccg
caggacagccgctgcaacagctggcggttgggcacagaggcgtcgctgccgctggcgggc
gcccaggtgtccacccccgcttttgatgaactccagaccagcgcgccggctcgcagggcg
ctctggcaacaaatctgcgcacatgaacacgatttctaccctcagcacggctga

DBGET integrated database retrieval system