KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_02330Help
Entry
KPN2242_02330     CDS       T01982                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    KPN2242_02330 (deoA)
Enzymes [BR:kpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     KPN2242_02330 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
493923..495245
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSAALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAADDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPSDFVENYANYLPTAMLSKAVYADTEGFISAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTEMARLGDRVDGQRPLAVIHAKDENSWQEAAKAVKAA
IKLDDKAPEITPTVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcaggcattaagcgatgaa
gagatccgctttttcatcaacggcatccgcgacaatactatctctgaagggcagatcgcc
gcgctggcgatgaccatcttcttccacgatatgtctatgccggagcgcgtttcgctgacc
atggcgatgcgggattccggtaccgttctggactggaaaagcctcaaccttaacggtccg
atcgtcgataaacactctaccggcggcgtcggggatgtcacttcgctgatgctggggccg
atggtggccgcctgcggtggttacgtaccgatgatctccggccgcggcctcggccatacc
ggcggtacgctggacaaactggaagcgatcccgggcttcgatatcttcccggacgacaac
cgcttccgcgagattataaaagatgttggcgtggcaattatcgggcagaccagctccctt
gccccggccgacaaacgtttctatgccacccgcgatattaccgcgacggtggactccatc
ccgctgattaccgcctcgattctggcgaagaagctggcggaagggctggatgcgctggtg
atggacgtcaaagtcggcagcggcgcctttatgccgacttatgaactctctgccgcgctg
gccgaagcgatcgtgggtgtcgccaacggcgccggcgtgcgcaccaccgcgctgctgacc
gatatgaatcaggtactggcctccagcgccggcaacgccgttgaagttcgcgaagcggtg
cagttcctgaccggcgaatatcgcaacccgcgcctgttcgacgtgacaatggcgctgtgt
gtggaaatgctgatctccggcaagctggcggcggacgatgccgaggcgcgcgcgaagctg
caggcggtgctggataacggtaaagcggcggaagtgtttggccgcatggtcgcggcgcag
aaagggccgagcgactttgtcgagaattatgctaattatctgccgacggcgatgctgagc
aaagcagtctatgctgataccgaaggttttatcagcgcgatggatactcgcgcgctgggc
atggcagtggtttctatgggcggcggccgccgtcaggcatcggacaccattgactatagc
gttggctttaccgagatggcgcgtctgggtgaccgcgtcgacggacagcgtccgctggcg
gtgatccatgccaaagacgagaacagctggcaggaggccgcgaaagcggtcaaagcggcc
attaaactggacgataaagccccggaaattacaccgacagtctatcgccgtatcactgaa
tag

DBGET integrated database retrieval system