KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_02655Help
Entry
KPN2242_02655     CDS       T01982                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kpo00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:kpo00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
565696..566175
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNI
VISSKPGSDDRVQWVSSVEEAIAACGDVEEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
GDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtctgattgcggcgttagcggtagatcgcgtcattggtatggaaaacgccatg
ccatggaacctgcctgccgatctcgcctggttcaaacgcaacacgttaaataagccggtg
gtgatggggcgtctgacctgggaatccattgggcgcccattgccggggcgtaaaaatatc
gtgatcagcagcaaacccggcagcgacgatcgcgtgcagtgggtctcctccgtagaagaa
gcaattgccgcctgcggcgatgtggaagagattatggtgatcggcggcggccgggtgtat
gagcagttcctgccgaaagcgcagaagctctacttgacccatattgatgcggaagtggaa
ggcgatacccatttcccggattacgatccggacgaatgggagtcggtgttcagcgagttt
catgacgccgacgcgcagaactcccatagctactgctttgagatcctcgaacgccgttaa

DBGET integrated database retrieval system