KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_03150Help
Entry
KPN2242_03150     CDS       T01982                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KPN2242_03150
Enzymes [BR:kpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     KPN2242_03150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(682826..683305)
Genome map
AA seq 159 aa AA seqDB search
MTLVYIALGSNLASPLEQVQAAIRALGEIPHSRVVAVSSFYRTPPLGPQDQPDYLNAAVA
LETALPPETLLDHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDAVINSERLTVPHYDMK
NRGFMLWPLFEIAPDLHFPDGLALRAVLDNLGAAKPASW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactctggtctatatcgctcttggcagcaaccttgcttctccactggagcaggtgcag
gcggctatccgcgccctgggcgaaattccgcacagccgcgtggtcgccgtctcttcgttc
taccgcacgccgccgctgggcccgcaggatcagccggactatctcaacgccgccgttgcg
ctggaaaccgccctgccccccgagacgctgctcgatcatactcagcgcatcgaactgcag
caggggcgagtgcgcaaagccgaacgctgggggccgcgcacgctggacctcgatatcatg
ctgtttggcgatgctgtcattaacagcgagcgcctgaccgttccgcactacgatatgaaa
aaccgcggctttatgctctggccgctgttcgagatcgccccggaccttcactttcctgac
ggcctggcgctgcgcgccgtgctggataatctcggcgcggcaaagcccgccagctggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system