KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_03740Help
Entry
KPN2242_03740     CDS       T01982                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00010  Glycolysis / Gluconeogenesis
kpo00020  Citrate cycle (TCA cycle)
kpo00620  Pyruvate metabolism
kpo01100  Metabolic pathways
kpo01110  Biosynthesis of secondary metabolites
kpo01120  Microbial metabolism in diverse environments
kpo01130  Biosynthesis of antibiotics
kpo01200  Carbon metabolism
Module
kpo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN2242_03740
   00020 Citrate cycle (TCA cycle)
    KPN2242_03740
   00620 Pyruvate metabolism
    KPN2242_03740
Enzymes [BR:kpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KPN2242_03740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: AEJ96668
Position
complement(812825..814360)
Genome map
AA seq 511 aa AA seqDB search
MSEIKTLEMPKWGLSMEEGLLARWAIQEGDDFTRGQEICEIETSKIVNVLEAPFAGTLRR
IIAREGETLQVGAVLALAADASVSDAELDEFAASLATVKPAAPGPEAAAPDVAAQAGAKP
PSVVSPPSNSPEPPVGQTVIPVSLQGVTDVTQVNATPHALRLSARWGVDLKKVRGSGRGE
RISVSDLESAIVAAGGRLASPTPPVRPSKAPRSHADDSQVSATPLARRLAGKLGINLHDC
RSSGSRGRVSRDDVLAASLLLDGPPQTSPVQESAPAPFESIPMSGMRRAIASRLQTSKQQ
SPHFRLSVDLDLERLLAFRQEINREVPGVKISVNDLLVKACALALVAVPDVNIQFDEAAQ
SIRRFTDADISVAVALPAGLITPIVRSANRKSISDISNEIHSLVTRAKAGTLKPEEFQGG
TFSLSNLGMLGVRQFDAIINPPQSAILAIGAGEVRAVVRDGQIVARQQMTVSLSCDHRVI
DGAAGAAFLRELKRLIETPTLMFIQETSYAR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatcaagacgcttgaaatgccaaagtgggggctttccatggaggaaggcttg
ctcgctcgatgggcaatccaggagggtgacgatttcaccagagggcaggaaatctgtgag
attgaaaccagtaaaatcgtcaatgtgctggaggcaccttttgccggtacattacgccgg
ataatcgcccgagagggtgagacgcttcaggttggcgccgtgctggctctggcggctgac
gcttcggtcagcgatgctgaactggacgaatttgctgccagtctggcgacagtgaaaccc
gcagcacctggcccggaggctgccgcgccggacgtagcggcacaggcaggcgctaagcca
ccttccgttgtttcgccgccatccaacagtccggagccccctgttgggcagaccgtcatc
cccgtcagtctgcaaggcgtgaccgatgtgactcaggttaatgccacgccccatgcgtta
cgactgtctgcccgctggggtgtcgacctgaaaaaggtccgcggcagcgggcgcggggaa
cgtatctctgtttctgatctggaaagcgcgatcgttgccgccggcggtcgcctggcctct
ccgacgccccccgttcgtcccagcaaagcgccccgctcgcatgccgatgatagccaggta
tcggccaccccgctggcgcgccgtctggccggcaaactgggtatcaacttgcatgactgc
cgaagcagcggttcacgcggtcgggtgagtcgcgatgatgtgctggctgcgtcgttgttg
ctcgacgggcccccgcagaccagccctgtgcaggagagtgccccggcaccctttgagagc
atccccatgtccggtatgcggcgggctatcgcttctcgcctgcaaacctccaagcaacag
tctccccatttccgtttgagtgtcgatctcgatctggaacgactgttagcgtttcgtcag
gaaattaaccgcgaagtacccggtgtcaagatttcggttaacgacctgctggtgaaggcc
tgtgccctggcgctggtggccgtgccagacgtcaacatccagtttgatgaagcggcacaa
agtatccgccgctttacggatgccgacatttcggtggccgttgcgctgcctgccgggcta
attacccctattgttcgctcggcgaaccggaaatcgatcagcgacatatcgaacgaaatt
cactcgctggtgaccagagccaaagcgggcacgctgaagccggaagagttccagggcggg
acctttagcctgtcaaatctggggatgctcggcgtccggcagtttgacgccatcatcaat
ccaccgcaaagcgcaatcctcgccattggcgccggcgaggtccgggcggtagtacgcgac
gggcaaatcgtcgcgcgccagcaaatgacggtatcgctatcctgcgatcaccgggtcatc
gatggcgcggcaggtgcggcttttctccgggaactcaagcgactgattgaaaccccgacc
ttgatgtttatccaggagacgagctatgcacgataa

DBGET integrated database retrieval system