KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_03740Help
Entry
KPN2242_03740     CDS       T01982                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPN2242_03740
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN2242_03740
   00020 Citrate cycle (TCA cycle)
    KPN2242_03740
   00620 Pyruvate metabolism
    KPN2242_03740
Enzymes [BR:kpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KPN2242_03740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(812825..814360)
Genome map
AA seq 511 aa AA seqDB search
MSEIKTLEMPKWGLSMEEGLLARWAIQEGDDFTRGQEICEIETSKIVNVLEAPFAGTLRR
IIAREGETLQVGAVLALAADASVSDAELDEFAASLATVKPAAPGPEAAAPDVAAQAGAKP
PSVVSPPSNSPEPPVGQTVIPVSLQGVTDVTQVNATPHALRLSARWGVDLKKVRGSGRGE
RISVSDLESAIVAAGGRLASPTPPVRPSKAPRSHADDSQVSATPLARRLAGKLGINLHDC
RSSGSRGRVSRDDVLAASLLLDGPPQTSPVQESAPAPFESIPMSGMRRAIASRLQTSKQQ
SPHFRLSVDLDLERLLAFRQEINREVPGVKISVNDLLVKACALALVAVPDVNIQFDEAAQ
SIRRFTDADISVAVALPAGLITPIVRSANRKSISDISNEIHSLVTRAKAGTLKPEEFQGG
TFSLSNLGMLGVRQFDAIINPPQSAILAIGAGEVRAVVRDGQIVARQQMTVSLSCDHRVI
DGAAGAAFLRELKRLIETPTLMFIQETSYAR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatcaagacgcttgaaatgccaaagtgggggctttccatggaggaaggcttg
ctcgctcgatgggcaatccaggagggtgacgatttcaccagagggcaggaaatctgtgag
attgaaaccagtaaaatcgtcaatgtgctggaggcaccttttgccggtacattacgccgg
ataatcgcccgagagggtgagacgcttcaggttggcgccgtgctggctctggcggctgac
gcttcggtcagcgatgctgaactggacgaatttgctgccagtctggcgacagtgaaaccc
gcagcacctggcccggaggctgccgcgccggacgtagcggcacaggcaggcgctaagcca
ccttccgttgtttcgccgccatccaacagtccggagccccctgttgggcagaccgtcatc
cccgtcagtctgcaaggcgtgaccgatgtgactcaggttaatgccacgccccatgcgtta
cgactgtctgcccgctggggtgtcgacctgaaaaaggtccgcggcagcgggcgcggggaa
cgtatctctgtttctgatctggaaagcgcgatcgttgccgccggcggtcgcctggcctct
ccgacgccccccgttcgtcccagcaaagcgccccgctcgcatgccgatgatagccaggta
tcggccaccccgctggcgcgccgtctggccggcaaactgggtatcaacttgcatgactgc
cgaagcagcggttcacgcggtcgggtgagtcgcgatgatgtgctggctgcgtcgttgttg
ctcgacgggcccccgcagaccagccctgtgcaggagagtgccccggcaccctttgagagc
atccccatgtccggtatgcggcgggctatcgcttctcgcctgcaaacctccaagcaacag
tctccccatttccgtttgagtgtcgatctcgatctggaacgactgttagcgtttcgtcag
gaaattaaccgcgaagtacccggtgtcaagatttcggttaacgacctgctggtgaaggcc
tgtgccctggcgctggtggccgtgccagacgtcaacatccagtttgatgaagcggcacaa
agtatccgccgctttacggatgccgacatttcggtggccgttgcgctgcctgccgggcta
attacccctattgttcgctcggcgaaccggaaatcgatcagcgacatatcgaacgaaatt
cactcgctggtgaccagagccaaagcgggcacgctgaagccggaagagttccagggcggg
acctttagcctgtcaaatctggggatgctcggcgtccggcagtttgacgccatcatcaat
ccaccgcaaagcgcaatcctcgccattggcgccggcgaggtccgggcggtagtacgcgac
gggcaaatcgtcgcgcgccagcaaatgacggtatcgctatcctgcgatcaccgggtcatc
gatggcgcggcaggtgcggcttttctccgggaactcaagcgactgattgaaaccccgacc
ttgatgtttatccaggagacgagctatgcacgataa

DBGET integrated database retrieval system