KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_04675Help
Entry
KPN2242_04675     CDS       T01982                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:kpo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1007181..1007786
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQYSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLEAESITEVILATNPTVEGEATANYIAELCAQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKITF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctgttaactcagcttatggaagcgctgcgctgtctgccgggcgtc
ggcccgaagtcagcgcagcgcatggcgtttaccctgctgcagcgcgatcgcagcggcggg
atgcgcctggcgcaggcgctgacgcgtgcgatgtcggagatcggccactgcgccgattgc
cgcaccttcaccgagcaggaggtgtgcaatatctgcagcaacccgcgtcgccaggaaaac
ggccagatctgtgtggtagagagtccggcggacatctatgccattgagcagaccgggcag
tattccggccgctacttcgtgctgatggggcacctgtcgccgctcgacggcatcgggcct
gatgacatcgggctcgatcgcctggagcaacggctggaggcggagtcgatcaccgaggtg
atcctcgccaccaacccgaccgttgagggcgaggcgacggccaactacatcgcggagctg
tgcgcgcagtatggcgtcgacgccagccgaatcgcccacggcgtgccggtgggcggcgag
ctggagatggtcgacggcaccacgctgtcccactccctggccggtcgccacaagattact
ttctga

DBGET integrated database retrieval system