KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_05025Help
Entry
KPN2242_05025     CDS       T01982                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Brite
Enzymes [BR:kpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     KPN2242_05025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1059731..1060234
Genome map
AA seq 167 aa AA seqDB search
MTPSMRNKLIGVIAGGGGAIAIASALITGPAGNDGLEGVRYNPYQDVVGVWTVCYGHTGK
DIMLGKKYTEAECRALLSKDLNTVARQINPYIQKPIPETMRGALYSFAYNVGAGNFQTST
LLRKINQGDQKGACDQLRRWTYAKGKQWKGLVTRREIEREVCLWGQK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgacgccatcaatgaggaataaactgattggcgtgatcgccggcggtggtggcgccata
gccattgcatctgcgctcatcactggcccagccggtaacgatggtcttgaaggtgtgcgg
tacaacccctatcaggatgtggtaggcgtctggactgtctgttatggccacactggcaaa
gacatcatgctcggcaagaagtacaccgaggctgaatgccgtgcgcttctcagtaaagac
ctgaacaccgtcgcccgccagattaacccatacatccagaagccgatccccgagacaatg
cgcggggctctgtactcgttcgcttataacgtcggcgctggcaacttccagacctccacg
cttctgcgcaaaatcaaccagggcgaccagaaaggtgcatgtgatcagctgcgccgctgg
acttatgccaagggcaaacagtggaaaggtctggtaactcgccgcgagattgagcgcgaa
gtttgtttgtgggggcagaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system