KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_05845Help
Entry
KPN2242_05845     CDS       T01982                                 

Definition
FGGY-like carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    KPN2242_05845
Enzymes [BR:kpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     KPN2242_05845
Exosome [BR:kpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPN2242_05845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1232132..1233652)
Genome map
AA seq 506 aa AA seqDB search
MQATAKEFIIALDEGTTNAKAVVLDSRGKVIVKFSQPLAIQTPRDGWVEQSGETLVTASL
TVIASAVAHVGAENVAALAISNQRETAIGWYRDSGEPINAAITWQCTRSAAFCDTLRHDR
QEQHIKRATGLPIAPLFSASKMRWLLDATVDGHLRAERGEICLGTIDSWLLWNLTAGEAF
CCDYSNASRTQLLNLHRGEWDDEMLALFGIPRAALPEIKPSSGLFGHTKGLAAIPDGIPI
MSMIGDSHAALFGHALGEAGCVKATYGTGSSVMAPVKSAQCDIDALATTVAWHDGDQLVW
GLEGNIPHTGDAVAWMADSTGLSELSAAELAHELNTLPASVDSTLGVYFVPALTGLGAPW
WDDSARGVICGLSRGVKRAHLIRAALESITYQIADVVVAMRQHEEFTLTALMVDGGPTNN
DWLMQYQADLLGCPVMRSDVPELSAIGAALLARKALHPGSTADLQAFLTEHSTFQPDMAR
HQRLQTRWQEWRHAVDRTLWKPDSPA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgacagcaaaagagttcatcattgccctggatgaaggcaccaccaacgccaaa
gcggtggtgctggatagccggggcaaagttatcgtcaaattctcgcagccgctggcgatc
caaacgccgcgcgacggctgggtggagcaatcgggcgaaacgctggttaccgcctcactg
acggtgatcgccagcgcggtggcccacgttggcgcggaaaacgtcgccgcgctggccatc
agcaaccagcgggaaaccgccatcggctggtatcgcgacagcggcgaaccgattaacgcg
gccattacctggcaatgcacccgcagcgccgcgttctgcgacacactgcgtcacgatcgt
caggaacagcacattaagcgtgccaccggcctgccaatcgccccgctgttctcggcctcc
aaaatgcgctggctgctggatgcgactgtcgatggccacctgcgcgccgaacgcggcgaa
atttgcctcggcaccatcgacagctggctgctgtggaatctgaccgccggagaagccttc
tgctgcgactactccaacgcctcccgcacccagttgttgaatctgcaccgcggcgagtgg
gacgacgagatgctggcgctgttcggcattccgcgcgcggcgttgccggaaattaaaccg
tcgagcggcctcttcggccataccaaaggactggccgccattccggacggtattccgatc
atgtcgatgatcggcgactcccacgccgcgctgttcggccacgcgctcggcgaggcaggc
tgcgtcaaagccacctacggcaccggctcttcggtcatggccccggtcaaatcggcgcag
tgcgatatcgacgcgctggcgaccaccgtcgcctggcacgatggcgaccagctggtgtgg
ggcctggaagggaatattccccacaccggcgatgctgtcgcctggatggcggacagcacc
ggactgagcgaactctctgccgccgagctggcccatgagctgaataccctccccgcctcc
gtcgactcaaccctcggggtctacttcgtgccggcgctgaccggtcttggcgcgccctgg
tgggatgacagcgcccgcggcgtgatttgcggcctgagtcgcggggtgaaacgcgcgcat
ctgatccgtgcggcgctggagtccatcacctatcagatagccgacgtggtggtggcgatg
cgtcagcatgaggagttcaccctgacggcgttgatggtggacggcgggccgaccaacaat
gactggctgatgcaataccaggccgatctgctcggctgcccggtgatgcgcagcgacgtg
ccggagctgtccgccatcggcgcggcgttgctggcacgcaaagcgctccatccgggatcg
accgccgatctgcaggccttcttaaccgaacatagcacctttcagcccgacatggcccgc
caccagcgcttacaaacgcgctggcaggagtggcgccatgcggtcgaccgaacattatgg
aaaccggactcgccagcctga

DBGET integrated database retrieval system