KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_06085Help
Entry
KPN2242_06085     CDS       T01982                                 

Definition
putative acireductone dioxygenase, ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:kpo00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1289905..1290447)
Genome map
AA seq 180 aa AA seqDB search
MSALTLFSVTDPQTPVWHSTDASAIQAQLNAKGVRFERWQADRDLGANPSPETVIAAYQH
EIDKLVAEKGYQSWDVISLRADNPQKEALREKFLNEHTHGEDEVRFFVEGAGLFCLHIGD
EVFQVLCEKNDLISVPAHTPHWFDMGSEPNFTAIRIFDNPEGWIAQFTGDDIASAYPRLA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattaacacttttttccgtgaccgatccgcaaacgccggtctggcacagcacc
gacgccagcgcgattcaggcgcagcttaacgccaaaggcgtccgtttcgagcgctggcag
gccgaccgcgacctcggcgcaaatcccagcccggaaacggtgattgccgcctatcagcat
gagattgataaactggtcgccgaaaagggctaccagagctgggacgtcatcagcctgcgc
gccgataacccgcaaaaagaggcgctgcgggaaaagttcctgaacgagcacacccatggc
gaagacgaggtccggttttttgtcgagggcgctggcctgttttgcctgcacattggcgac
gaggtgttccaggtgctgtgcgaaaagaacgatctgatttcggttcccgcccacactccg
cactggtttgatatgggatcagaaccgaacttcaccgccattcgcatttttgataacccg
gaaggctggatcgcccagtttaccggcgacgatatcgccagcgcctacccgcggctggcg
taa

DBGET integrated database retrieval system