KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_06495Help
Entry
KPN2242_06495     CDS       T01982                                 

Gene name
sdhD
Definition
succinate dehydrogenase cytochrome b556 small membrane subunit (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPN2242_06495 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPN2242_06495 (sdhD)
   00650 Butanoate metabolism
    KPN2242_06495 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    KPN2242_06495 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1376630..1376977
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATTGEISWEVWTGFFASGFTKVF
TLLALVSILIHAWIGMWQVLTDYVKPLALRLVLQLAIVVALVAYVLYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctcagcactgggacgcaacggcgtacatgactttatcctggtccgt
gctaccgccatcgttctgaccctctacatcatctacatggttggcttcttcgccaccacc
ggtgaaatctcatgggaagtgtggaccggattctttgcctccggcttcactaaagtcttc
actctgctggctctcgtttccattctcatccatgcctggatcgggatgtggcaggtgtta
acagactacgttaaaccactggctctgcgcctggttctgcaactggctatcgttgtggcg
ctggtggcttacgttctttatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system