KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_06615Help
Entry
KPN2242_06615     CDS       T01982                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPN2242_06615 (gpmA)
   01230 Biosynthesis of amino acids
    KPN2242_06615 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN2242_06615 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    KPN2242_06615 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPN2242_06615 (gpmA)
Enzymes [BR:kpo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KPN2242_06615 (gpmA)
Exosome [BR:kpo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KPN2242_06615 (gpmA)
  Exosomal proteins of melanoma cells
   KPN2242_06615 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1402287..1403039)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKAEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNAEEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactggttcgtcatggcgaaagccagtggaacaacgaaaac
cgcttcaccggttggtacgacgtggatctgtccgagaaaggcgttagcgaagcgaaagca
gcgggtaaactgctgaaggctgaaggcttcagctttgattttgcttatacctccgtgctg
aaacgtgccatccacaccctgtggaacgtgctggacgaactggatcaggcctggctgccg
gttgagaaatcctggaagctgaacgagcgtcattacggcgcgctgcagggcctgaacaaa
gcggaaaccgctgagaaatatggtgacgagcaggttaaacagtggcgtcgcggcttcgct
gtcactccgccggagctgaccaaagacgacgagcgctacccgggccacgatccgcgctat
gcaaaactgaccgacgccgaactgccgaccactgaaagcctggcgctgactatcgaccgc
gtcgtgccttactggaacgaaaccattctgccgcgcctgaaaagcggtgagcgcgtgatc
atcgccgctcacggtaactccctgcgcgcgctggtgaaatacctcgacaacatgggcgaa
gacgagatcctcgaactgaacatcccgaccggcgtaccgctggtgtatgagttcgatgaa
aacttcaagccgatcaaacattactatctgggcaatgcggaagagatcgcggcgaaagcg
gctgccgtcgccaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system