KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_08340Help
Entry
KPN2242_08340     CDS       T01982                                 

Definition
(GenBank) putative arginase/agmatinase/formimionoglutamate hydrolase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00220  Arginine biosynthesis
kpo00330  Arginine and proline metabolism
kpo01100  Metabolic pathways
kpo01110  Biosynthesis of secondary metabolites
kpo01130  Biosynthesis of antibiotics
kpo01230  Biosynthesis of amino acids
Module
kpo_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    KPN2242_08340
   00330 Arginine and proline metabolism
    KPN2242_08340
Enzymes [BR:kpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KPN2242_08340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEJ97584
Position
complement(1766499..1767362)
Genome map
AA seq 287 aa AA seqDB search
MTSKTLRLIFPQWQGGNNPPYYLGSQLLSFLSPEAKGPVEIVPVELPTTEPLPRINDITA
KPSLIRQLNNAAALIEKHDPNSIVILGGDCLVSLAPFAHLLDKFGDKLGVLWIDSHPDVQ
TAEQYPNAHAHVLGALMGTGDNDLVAHVKTKLNPSKIMIAGIHAPLPYEAEYLTRHNITT
LAPEQVKSGADEVLEWIAKEKIAYLAIHIDLDVLDPSLFRSILFAKPGRGKHDFGDVAEG
KLTIEDVLNLIAAATTKAVPVGLTIAEHLPWDMLNLKNMLSELPLLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgactagcaaaacactgcgacttatatttcctcaatggcaaggcggtaacaatcctccc
tactatcttggctcgcagctcctctcgtttctctctcctgaagcaaaagggcccgttgag
atcgttcctgttgagttaccaacaacagagccattgccaaggattaatgacatcacggct
aagccatccctcatcaggcaactcaataatgctgccgcactgattgaaaaacatgatccc
aatagcattgtcattttaggcggagactgcctggtttcgctggcgcctttcgcccacctg
ctcgataagttcggagacaaactcggtgtgctctggattgactcgcatcctgacgtgcag
acggctgaacaatatccaaacgcgcatgcccatgtgcttggtgcgctaatgggtacgggt
gataacgatttagttgcccatgtaaaaaccaaacttaatccgtcaaaaataatgattgcc
ggtatccacgcgccacttccttatgaagctgaatacctcactcgccataacattacgacg
ctagcacctgaacaggttaaaagcggtgcagatgaagtcctggagtggatagcgaaagaa
aagattgcgtatctggcgatccatatcgatctggacgtactcgacccatctctgttccgc
tccattctttttgcaaaaccggggcgcggaaaacacgattttggcgacgttgctgaaggc
aaactgacgattgaggatgtactcaatctgatagcggcagcgacgacaaaagcagtcccc
gttggcctgacaatcgctgaacatttgccctgggacatgctgaatctcaagaacatgctc
agtgaattaccccttctaaagtaa

DBGET integrated database retrieval system