KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_08585Help
Entry
KPN2242_08585     CDS       T01982                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KPN2242_08585
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    KPN2242_08585
Enzymes [BR:kpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     KPN2242_08585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1814889..1815911
Genome map
AA seq 340 aa AA seqDB search
MGPVMLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIRDASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAAEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHEDPQKALTMARHFIDGMHAAGMKTTGKHFPGHGAVTADSHKETP
FDPRAASVIRDHDMAVFKSLIAEQRLDAIMPAHVIYPELDPRPASGSAYWLKTVLRGELG
FDGVIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TKLYHKGSFSRQELRDSARWKTVSAQLEQLHARWQEAKSA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccagtgatgttggatgtcgaagggtatgagctggatgcggaagagcgagaaatt
ctggcgcatccgctggtgggagggttgatcctctttacccgaaattatcacgatccggcg
cagttgcgcgagctggtgcgccagatccgcgacgcctcccggaaccacctggtggtagcg
gtcgatcaggaaggggggcgggttcagcgtttccgcgaagggtttacccgtttaccggcg
gcccagtctttcgccgcgctgctggggatggaagaggggggcaaactggccgccgaagcc
ggctggctgatggccagcgaaatgatcgccatggatatcgatattagttttgcgccagtg
ctggacgtcggccatatcagcgccgcaatcggcgaacgttcttatcatgaagatccgcag
aaagcgctgacgatggcgcgtcacttcattgacgggatgcacgccgcgggcatgaaaacc
accggcaaacacttcccgggtcacggggcggtgactgccgattcgcacaaagagacgccg
ttcgatccgcgggcggcatcggttatccgcgaccatgatatggcggtgttcaaaagcctt
atcgccgagcagcgtctggatgccattatgccggcgcatgtgatttacccggagctcgat
ccgcgtccggccagcggctcggcgtactggctgaaaacggtgctgcgcggcgaactgggc
tttgacggggtgattttctccgacgatctgtcgatggaaggggcggcgatcatgggcagc
tatgccgaacgcggtcaggcatcgctcgacgccggttgcgatatgatcctcgtctgcaat
aatcgtaaaggcgcggtcagtgtgctggataacctgtcgccgatcaaagcagagcgtgtt
acgaaattgtatcataaaggttccttttcccgtcaggagttaagggattcagcccgttgg
aaaacggtgagtgcccagctggagcagcttcatgcgcgctggcaagaggcgaagtccgcg
taa

DBGET integrated database retrieval system