KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_09120Help
Entry
KPN2242_09120     CDS       T01982                                 

Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KPN2242_09120
Enzymes [BR:kpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     KPN2242_09120
    3.5.1.-  
     KPN2242_09120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1920771..1921412)
Genome map
AA seq 213 aa AA seqDB search
MAHRALLLVDLQNDFCAGGALAVPEGDSTVDVANALIDWSLARGEPIVASQDWHPADHGS
FASQHQVEPYTEGELDGLAQTFWPDHCVQHSEGAALHPLLKQQAIAAVFHKGQNRSIDSY
SAFFDNGHRQKTELDGWLRGQGIVELTVLGLATDYCVKFTVLDALALGYAVNVITDGCRG
VNLQPQDSSQAFMEMAAAGATLYTLDDWRETQA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcgagcgctgttactggttgatttgcagaacgacttttgcgccggcggcgcg
ctggcggttcctgaaggcgacagtaccgtcgacgtagccaatgcgcttatcgactggagc
ctggcgcgcggcgagcccatcgtcgccagccaggactggcatccggcggatcacggcagt
ttcgccagccagcaccaggtggaaccctacaccgagggcgagctggacggcctggcgcaa
actttctggccggatcactgcgtgcagcacagcgaaggcgcggcgctgcatcctctgctc
aagcagcaggcgatcgccgctgtgttccacaaagggcaaaaccggagcatcgacagctat
agcgctttctttgacaacggtcaccggcagaaaaccgaactggacggctggctgcgtggt
caggggatcgtggagctgaccgttctcggcctcgccaccgattactgcgttaagttcacc
gtgctggatgccctggcgctgggctacgcggtcaacgtcatcaccgacggctgtcgcggc
gtaaatctgcagccgcaggacagcagccaggcgtttatggagatggccgccgcgggcgcc
acgctctataccctcgacgactggcgggaaactcaggcctga

DBGET integrated database retrieval system