KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_09405Help
Entry
KPN2242_09405     CDS       T01982                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00260  Glycine, serine and threonine metabolism
kpo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kpo01100  Metabolic pathways
kpo01110  Biosynthesis of secondary metabolites
kpo01130  Biosynthesis of antibiotics
kpo01230  Biosynthesis of amino acids
Module
kpo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPN2242_09405
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KPN2242_09405
Enzymes [BR:kpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KPN2242_09405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Mic1
Motif
Other DBs
NCBI-ProteinID: AEJ97793
Position
complement(1976511..1977704)
Genome map
AA seq 397 aa AA seqDB search
MSTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPAFQAEFTNLLKNYAGRPTALT
KCRNLTEGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YEKAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEGRLPDAVIACVGGGSNAIGM
FADFIEETNVGLIGVEPAGHGIESGEHGAPLKHGRVGIYFGMKSPMMQTADGQIEESYSI
SAGLDFPSVGPQHAFLNSTGRADYVSITDDEALDAFKALSRHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttactgaacccctacttcggcgaattcggcggcatgtatgtgccgcagatc
ctgatgcccgccctgcgccagctggaagaagcctttgtcagcgcgcagaaggacccggcc
tttcaggcggaattcaccaacctgctgaaaaactacgccgggcgtccgacggccctgacc
aaatgccggaatctgaccgaaggcacccgcaccaccctgtacctgaaacgcgaagatctg
ctgcacggcggcgcgcacaaaaccaaccaggtgctgggccaggccctgctggccaaacgg
atgggtaaaaccgaaattatcgccgagaccggcgccggccagcacggcgtcgcctcagcg
ctggccagcgccctgctcggcctgaaatgccgtatctacatgggtgccaaggacgtcgag
cgccagtcgccgaacgtgttccgtatgcgcctgatgggcgccgaggtgatcccggtgcac
agcggctccgccacgctgaaagatgcctgtaacgaggcgctgcgcgactggtccggcagc
tacgaaaaggcgcactatatgctgggcaccgccgccggtccgcacccgttcccgacgatt
gtgcgtgaattccagcgcatgattggcgaagagaccaaagcgcagatccttgaaaaagag
ggccgcctgccggacgcggtgatcgcctgcgtcggcggcggatcaaacgccatcggcatg
ttcgctgattttatcgaggaaaccaacgtcggcctgatcggcgtggagcccgccggacac
ggtatcgagagcggcgagcacggcgcgccgctgaagcatggccgcgttgggatctacttc
ggtatgaagtcgccgatgatgcagaccgccgacggccagatcgaagagtcttactccatt
tccgccgggctggacttcccgtccgttgggccgcagcacgcgtttctgaacagcaccggt
cgcgctgactatgtgtcgatcaccgacgacgaagcgctggacgcgtttaaagcgctttcc
cgccacgaagggattatcccggcgctggagtcctctcacgctctggcccacgcgctgaag
atgatgcgcgagaacccggaaaaagagcagctgctggtggttaatctctccggccgcggc
gacaaagacattttcaccgtacatgacatcctgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system