KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_10400Help
Entry
KPN2242_10400     CDS       T01982                                 

Definition
dihydromonapterin reductase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kpo00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:kpo00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2193673..2194395)
Genome map
AA seq 240 aa AA seqDB search
MTEQQPRPILITGAGRRIGLALAHHFLQQRQPVIVSYRTPYPAIDGLREAGALCLQADFS
SDDGILTFAEAVKSHTNGLRAIIHNASDWMAEKPGVPLSTVINRMMQIHVNAPYLLNHAL
EALLRGHGHAASDIIHITDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNAIA
PSLIMFNEGDDEAYRQQALDKSLMKIAPGEKEISDLIDYLFTSRYVTGRSFAVDGGRPLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaacagccccgcccgattctgatcacaggagcaggccgccgcatcggcctc
gctctggcacaccattttctgcagcagcgccagccggtcatcgtcagctatcgtacgccc
tatccggcgattgacggcctgcgcgaagcgggcgcgctctgcctgcaggccgattttagc
agcgatgacggcattctgaccttcgctgaagcggtcaaatcacacaccaacggtctgcgc
gccatcatccataacgccagcgactggatggcggaaaagccgggcgtcccgctgagcacc
gtcatcaaccgcatgatgcagatccacgtcaacgccccctatctgctcaaccatgcgctg
gaggcgttgctgcgcggccacggccatgccgccagcgacattatccatatcaccgattac
gtggtggagcgcgggagcgacaaacatatcgcctatgccgccagcaaagccgccctggat
aacatgacccgctccttcgctcgcaagctggcgccagaggttaaggtcaacgccatcgcg
ccgtcgctaatcatgtttaatgagggtgacgacgaggcctatcgtcagcaggcgctggat
aaatcgctgatgaaaatcgcccctggcgaaaaagagattagcgatctcatcgattacctg
tttaccagccgctacgttaccggccgctcattcgctgtcgacggcggccgcccgctgcgc
tag

DBGET integrated database retrieval system