KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_11555Help
Entry
KPN2242_11555     CDS       T01982                                 

Definition
putative acetylornithine deacetylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kpo01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:kpo00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2417240..2418382
Genome map
AA seq 380 aa AA seqDB search
MTATLELARQLLGFNTINPPGCEADCMRFFADWLDDSGFEVSLSSFGEGRCNLIASLPGA
KSGKPLAFTGHLDTVPLGNARWQYDPFGSQMEDGRLYGRGSSDMKAAIAAFAVACVHQRE
AILAGRGAVLLITGGEETGCDGARALIASATLPEVGALIVGEPTANYPVIGHKGALWLRC
ETRGKTAHGAMPELGINAIYLAADALGKIQHFSPGAPHPLMKQPTLNVGRIEGGLNINSV
PDRTRFDVDIRSAPNLQHATIRERLTTLLGESVTVSTLVDLPAVLSREDHAWIKQVYQRC
QPLHAEPIAPRVVPYFTDASLLLPALGDPPCIILGPGEPSMAHQTDEYCLLSRLAEAEQL
YGDIIRDWMASPPATKVKNE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgactcttgagctcgcccggcagctgctgggctttaacaccatcaacccgccg
ggctgcgaagccgactgcatgcggttcttcgccgactggcttgacgatagcggttttgag
gtttcgctgtcgtcgttcggcgaaggacgctgcaatcttatcgccagcctgcccggggcg
aagagcggtaaaccgctggcctttaccggacatctggataccgtcccgctgggaaatgcc
cgctggcagtacgatcctttcggctcgcagatggaagacgggcgtctttatggccgcgga
tccagcgatatgaaagcggcgatagcggcgtttgccgtcgcctgcgttcatcagcgggaa
gcgatcctcgccggacgcggcgcggtattgctgataaccggcggagaagagaccggctgc
gacggcgcgcgggcgctgatcgcctccgcaacgttgccggaggtgggcgcgctgatcgtc
ggtgaacccaccgccaactatccggttatcggccataaaggcgcgctctggctacgctgc
gaaacgcgggggaaaaccgcccacggcgcgatgccggagctggggatcaatgctatttat
cttgcggcggatgcgttgggtaagattcagcatttttcgccaggcgcgccgcatccgcta
atgaagcaacccaccctcaacgtcggacgcatagaaggcggactcaatattaattccgta
ccggaccgcacgcgttttgatgtcgatatccgcagcgcgcccaatttacagcacgccact
atccgggagcgcttgacgacgctgcttggcgaaagcgtcaccgtctccacgctggtcgac
ctgcccgccgtcctcagccgggaggatcatgcgtggattaagcaggtttatcaacgctgt
cagccgctgcacgctgagccgattgcgccgcgcgtggtgccctactttaccgacgcctcg
ctgctgctgcctgcattgggcgatccgccctgtattattctcggccccggcgagccgtcg
atggcgcatcaaaccgacgaatactgcctgctcagccgactggcggaggccgaacagcta
tacggtgacatcattcgcgactggatggcatcaccgcccgcgacgaaagtaaaaaatgag
tga

DBGET integrated database retrieval system