KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_12185Help
Entry
KPN2242_12185     CDS       T01982                                 

Definition
ethanol-active dehydrogenase/acetaldehyde-active reductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KPN2242_12185
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN2242_12185
  Lipid metabolism
   00071 Fatty acid degradation
    KPN2242_12185
  Amino acid metabolism
   00350 Tyrosine metabolism
    KPN2242_12185
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KPN2242_12185
   00626 Naphthalene degradation
    KPN2242_12185
Enzymes [BR:kpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KPN2242_12185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2540401..2541411
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTHDHQVNVTEKTLRPLEYGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVQKVGPGVTSLKPGDRASVAWFFEGCGHCDYCNSGNETLCRSVKNAGYTVDGGMAEE
CIVTANYAVKVPDGLDSAAASSITCAGVTTYKAVKVSHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDGQLELAASMGADLTINSRNEDAAKVIQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIEVVGSLVGTRQDLVEAFQFAAEG
KVVPKVTLRPLEDINAIFKEMEQGQIRGRMVIDLRS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagctgttgttacccacgaccatcaggttaacgtcacggaaaaaacgctgcgc
ccgctggaatacggcgaagcgctgttgaaaatggaatgctgcggcgtgtgtcatactgac
ctgcacgtgaaaaacggcgattttggcgataaaaccggcgtcattctcggccatgaaggg
atcggggtggtacaaaaagtcggcccgggcgtcacctccctgaagccgggcgaccgcgcc
agcgtggcgtggttcttcgaaggctgcggccactgcgattactgtaacagcggcaacgag
acgctctgccgctcggtgaaaaacgccggctataccgtcgatggcggcatggcggaagag
tgcatcgtcaccgccaactacgcggtaaaagttccggacggcctcgactccgccgccgcc
agcagcatcacctgcgcgggcgtcaccacctacaaagcggtcaaggtctcccacatcaaa
ccgggccagtggatcgccatctacggcctcggcgggctgggtaacctcgcgctgcagtat
gcgaagaatgtgtttaacgccaaagtgatcgctatcgacgtcaacgacggacagctggag
ctggcggcctcgatgggcgccgacctgaccatcaactcccgcaatgaagatgcggcgaaa
gtgattcaggaaaaaaccggcggcgcccacgctgcggtagtaaccgcggtggctaaagcg
gcctttaactcggcggtggatgccgttcgcgccggtggccgcgtggttgcggtgggcctg
ccgccggaggcgatgagcctcgatattccgcgtctggtgctggacggcatcgaagtggtc
ggttcgctggtcggcacccgtcaggatctggtggaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcaccctgcgtccgctggaagatatcaacgctatcttcaaagag
atggagcaaggtcagatccgcggccgtatggttatcgatctgcgtagctaa

DBGET integrated database retrieval system