KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_12185Help
Entry
KPN2242_12185     CDS       T01982                                 

Definition
(GenBank) ethanol-active dehydrogenase/acetaldehyde-active reductase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00010  Glycolysis / Gluconeogenesis
kpo00071  Fatty acid degradation
kpo00350  Tyrosine metabolism
kpo00625  Chloroalkane and chloroalkene degradation
kpo00626  Naphthalene degradation
kpo01100  Metabolic pathways
kpo01110  Biosynthesis of secondary metabolites
kpo01120  Microbial metabolism in diverse environments
kpo01130  Biosynthesis of antibiotics
kpo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN2242_12185
  Lipid metabolism
   00071 Fatty acid degradation
    KPN2242_12185
  Amino acid metabolism
   00350 Tyrosine metabolism
    KPN2242_12185
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KPN2242_12185
   00626 Naphthalene degradation
    KPN2242_12185
Enzymes [BR:kpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KPN2242_12185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEJ98335
Position
2540401..2541411
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTHDHQVNVTEKTLRPLEYGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVQKVGPGVTSLKPGDRASVAWFFEGCGHCDYCNSGNETLCRSVKNAGYTVDGGMAEE
CIVTANYAVKVPDGLDSAAASSITCAGVTTYKAVKVSHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDGQLELAASMGADLTINSRNEDAAKVIQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIEVVGSLVGTRQDLVEAFQFAAEG
KVVPKVTLRPLEDINAIFKEMEQGQIRGRMVIDLRS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagctgttgttacccacgaccatcaggttaacgtcacggaaaaaacgctgcgc
ccgctggaatacggcgaagcgctgttgaaaatggaatgctgcggcgtgtgtcatactgac
ctgcacgtgaaaaacggcgattttggcgataaaaccggcgtcattctcggccatgaaggg
atcggggtggtacaaaaagtcggcccgggcgtcacctccctgaagccgggcgaccgcgcc
agcgtggcgtggttcttcgaaggctgcggccactgcgattactgtaacagcggcaacgag
acgctctgccgctcggtgaaaaacgccggctataccgtcgatggcggcatggcggaagag
tgcatcgtcaccgccaactacgcggtaaaagttccggacggcctcgactccgccgccgcc
agcagcatcacctgcgcgggcgtcaccacctacaaagcggtcaaggtctcccacatcaaa
ccgggccagtggatcgccatctacggcctcggcgggctgggtaacctcgcgctgcagtat
gcgaagaatgtgtttaacgccaaagtgatcgctatcgacgtcaacgacggacagctggag
ctggcggcctcgatgggcgccgacctgaccatcaactcccgcaatgaagatgcggcgaaa
gtgattcaggaaaaaaccggcggcgcccacgctgcggtagtaaccgcggtggctaaagcg
gcctttaactcggcggtggatgccgttcgcgccggtggccgcgtggttgcggtgggcctg
ccgccggaggcgatgagcctcgatattccgcgtctggtgctggacggcatcgaagtggtc
ggttcgctggtcggcacccgtcaggatctggtggaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcaccctgcgtccgctggaagatatcaacgctatcttcaaagag
atggagcaaggtcagatccgcggccgtatggttatcgatctgcgtagctaa

DBGET integrated database retrieval system