KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_13545Help
Entry
KPN2242_13545     CDS       T01982                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KPN2242_13545
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPN2242_13545
   00650 Butanoate metabolism
    KPN2242_13545
  Amino acid metabolism
   00360 Phenylalanine metabolism
    KPN2242_13545
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPN2242_13545
   00622 Xylene degradation
    KPN2242_13545
   00621 Dioxin degradation
    KPN2242_13545
Enzymes [BR:kpo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KPN2242_13545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2810452..2811402)
Genome map
AA seq 316 aa AA seqDB search
MRKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRLGVATTHEGVG
GLMQMAEFADIDFVFDATSAGAHIKNDAALREAKPGIRVIDLTPAAIGPYCVPVVNLAAN
LHQGNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASIASQSAGPGTRANIDEFTETTSQ
AIEKVGGAGKGKAIIVLNPAEPPLMMRDTVYVLSELASQEAIAASIAEMAAAVQAYVPGY
RLKQQVQFEVIPEDRPVNLPGVGCFSGLKTAVYLEVEGAAHYLPAYAGNLDIITSAALAT
AEQMAGAMHSAAGATA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacgtaaagtcgccattatcggctccgggaatatcggcaccgatttaatgatt
aaaatcctgcgccacggccagcatctggagatggcggtgatggtcggcatcgacccgcag
tcggatggcctggcccgcgccaggcgcctgggcgttgcgaccactcacgaaggggtgggc
ggcctgatgcagatggcggaatttgccgacatcgattttgtttttgacgccaccagcgcc
ggggcgcacatcaaaaacgatgccgcgctgcgcgaagcgaagccggggatccgcgttatc
gacctgacgccggcggcgattggcccatactgcgtaccggtggtcaacctcgcggccaat
ctccatcagggcaacgtcaatatggtgacctgcggcgggcaggcgaccatcccaatggtc
gccgcggtctcgcgagtggcgaaggtgcattacgcggagatcgtggcctcgatcgccagc
caatccgccgggccgggcacgcgggccaatattgacgaatttaccgaaaccacctcgcag
gcgattgaaaaagtcggcggcgcgggcaagggcaaagcgattattgtactgaacccggcg
gagccgccgctgatgatgcgcgataccgtctacgtcctgagcgagctggcgtcgcaggag
gcgattgccgcctcgatcgccgaaatggcggcggcagtgcaggcttacgtcccgggctac
cggctgaagcagcaggtgcagtttgaggttatccccgaggacaggccggtcaacctgccc
ggcgtcggctgtttttccggcctgaaaaccgcggtttacctcgaagtggaaggggcggcg
cactatctgccagcgtacgcgggcaacctcgatattattacctcggcggcgctggcgacg
gcggagcaaatggccggggcaatgcacagcgcggcgggagcgacagcatga

DBGET integrated database retrieval system