KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_13890Help
Entry
KPN2242_13890     CDS       T01982                                 

Definition
(GenBank) 6-phosphofructokinase 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00010  Glycolysis / Gluconeogenesis
kpo00030  Pentose phosphate pathway
kpo00051  Fructose and mannose metabolism
kpo00052  Galactose metabolism
kpo00680  Methane metabolism
kpo01100  Metabolic pathways
kpo01110  Biosynthesis of secondary metabolites
kpo01120  Microbial metabolism in diverse environments
kpo01130  Biosynthesis of antibiotics
kpo01200  Carbon metabolism
kpo01230  Biosynthesis of amino acids
Module
kpo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN2242_13890
   00030 Pentose phosphate pathway
    KPN2242_13890
   00051 Fructose and mannose metabolism
    KPN2242_13890
   00052 Galactose metabolism
    KPN2242_13890
  Energy metabolism
   00680 Methane metabolism
    KPN2242_13890
Enzymes [BR:kpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KPN2242_13890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AEJ98668
Position
2882217..2883149
Genome map
AA seq 310 aa AA seqDB search
MTKIYTLTLAPSLDSATQTPQIYPEGKLRCSAPVFEPGGGGINVARAVTFLGGKATAIFP
VGGATGEHLAALLADEQVPVETVETRDWTRQNLHVHVAASGEQYRFVMPGAALTDDEFRR
LEEKVLTIEPGSLLVVSGSLPPGISVDNLMQLVKNAQQQGLRCIIDSSGDALAAALDVGN
IELVKPNQKELSALVQRDLSQPDDVRLAAQSLIQSGKVRRVVVSLGPQGALGVDASGSVQ
VVPPPMKSQSTVGAGDSMVGAMTLRLAENASLEDMVRFGVAAGSAATINQGTRLCSRANT
QKIYDYLCGC
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatttacacgctcacgctggccccctcgctggatagcgccacgcaaacccca
cagatctacccggaaggcaaacttcgctgcagcgcgccggtatttgaacctggcggcggc
gggatcaacgtggcccgcgccgtgacctttctcggcggcaaagccaccgccattttcccg
gtcggtggcgctaccggcgagcatcttgccgccctgctggccgatgagcaagtgccggtc
gagaccgtcgaaacccgcgactggacgcggcaaaacctgcacgtccacgtggccgccagc
ggcgaacagtatcgcttcgttatgcccggcgcggcactgacggacgatgaattccgccgt
ctggaagagaaggttctgactatcgaacccggctctctgctggtggtcagcggcagcctg
ccgccaggtattagcgttgataacctgatgcagctggtgaaaaatgcgcaacagcaggga
ctgcgctgcatcattgacagttccggcgatgcgctggccgccgcgctggacgtcggtaat
attgagctggtgaaaccgaaccagaaagagcttagcgccctcgtgcagcgcgatctcagc
caacccgatgacgtgcgccttgccgctcagtcgttgatccagtccggtaaagtgcgccgg
gtggtggtctccctgggtccgcagggggcattaggcgtggacgccagcggcagcgttcag
gtagtgccgccaccgatgaaaagccagagcaccgtcggcgctggcgacagcatggtgggc
gccatgaccttgcgtctggcggaaaacgccagccttgaagacatggtacgctttggcgtc
gccgccggtagcgccgcgaccatcaaccagggcacccgcctctgctcgcgggccaatacg
caaaaaatctatgattatctctgcgggtgttga

DBGET integrated database retrieval system