KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_13890Help
Entry
KPN2242_13890     CDS       T01982                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPN2242_13890
   01230 Biosynthesis of amino acids
    KPN2242_13890
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN2242_13890
   00030 Pentose phosphate pathway
    KPN2242_13890
   00051 Fructose and mannose metabolism
    KPN2242_13890
   00052 Galactose metabolism
    KPN2242_13890
  Energy metabolism
   00680 Methane metabolism
    KPN2242_13890
Enzymes [BR:kpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KPN2242_13890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2882217..2883149
Genome map
AA seq 310 aa AA seqDB search
MTKIYTLTLAPSLDSATQTPQIYPEGKLRCSAPVFEPGGGGINVARAVTFLGGKATAIFP
VGGATGEHLAALLADEQVPVETVETRDWTRQNLHVHVAASGEQYRFVMPGAALTDDEFRR
LEEKVLTIEPGSLLVVSGSLPPGISVDNLMQLVKNAQQQGLRCIIDSSGDALAAALDVGN
IELVKPNQKELSALVQRDLSQPDDVRLAAQSLIQSGKVRRVVVSLGPQGALGVDASGSVQ
VVPPPMKSQSTVGAGDSMVGAMTLRLAENASLEDMVRFGVAAGSAATINQGTRLCSRANT
QKIYDYLCGC
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatttacacgctcacgctggccccctcgctggatagcgccacgcaaacccca
cagatctacccggaaggcaaacttcgctgcagcgcgccggtatttgaacctggcggcggc
gggatcaacgtggcccgcgccgtgacctttctcggcggcaaagccaccgccattttcccg
gtcggtggcgctaccggcgagcatcttgccgccctgctggccgatgagcaagtgccggtc
gagaccgtcgaaacccgcgactggacgcggcaaaacctgcacgtccacgtggccgccagc
ggcgaacagtatcgcttcgttatgcccggcgcggcactgacggacgatgaattccgccgt
ctggaagagaaggttctgactatcgaacccggctctctgctggtggtcagcggcagcctg
ccgccaggtattagcgttgataacctgatgcagctggtgaaaaatgcgcaacagcaggga
ctgcgctgcatcattgacagttccggcgatgcgctggccgccgcgctggacgtcggtaat
attgagctggtgaaaccgaaccagaaagagcttagcgccctcgtgcagcgcgatctcagc
caacccgatgacgtgcgccttgccgctcagtcgttgatccagtccggtaaagtgcgccgg
gtggtggtctccctgggtccgcagggggcattaggcgtggacgccagcggcagcgttcag
gtagtgccgccaccgatgaaaagccagagcaccgtcggcgctggcgacagcatggtgggc
gccatgaccttgcgtctggcggaaaacgccagccttgaagacatggtacgctttggcgtc
gccgccggtagcgccgcgaccatcaaccagggcacccgcctctgctcgcgggccaatacg
caaaaaatctatgattatctctgcgggtgttga

DBGET integrated database retrieval system