KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_14015Help
Entry
KPN2242_14015     CDS       T01982                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KPN2242_14015
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN2242_14015
   00620 Pyruvate metabolism
    KPN2242_14015
   00650 Butanoate metabolism
    KPN2242_14015
  Lipid metabolism
   00071 Fatty acid degradation
    KPN2242_14015
  Amino acid metabolism
   00350 Tyrosine metabolism
    KPN2242_14015
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KPN2242_14015
   00626 Naphthalene degradation
    KPN2242_14015
Enzymes [BR:kpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KPN2242_14015
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KPN2242_14015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2904839..2907514
Genome map
AA seq 891 aa AA seqDB search
MAVTNIAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKEATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGALNAAIVGQP
AAKIAELAGFTVPATTKILIGEVTNVDESEPFAHEKLSPTLAMYRAKDFEDAVAKAEKLV
AMGGIGHTSCLYTDQDNQPARVAYFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLTIVRKGADLANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESIKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGREFVEGEAGAKAEVAPVKAEKKAKKSA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatatcgctgaactgaacgcgcttgttgagcgtgtcaagaaagcccag
cgtgaatatgccagtttcactcaagaacaagtcgacaaaatcttccgcgccgccgctctg
gccgctgcagatgctcgaatccctctcgccaaaatggccgtagccgaatccggcatgggc
atcgttgaagacaaagtgatcaaaaaccactttgcttccgaatacatttacaacgcttat
aaagacgaaaaaacctgtggcgttctgtcagaagacgacacctttggcaccatcactatc
gctgagcctatcggcatcatctgcggtatcgtaccgaccactaacccgacttcaacagcc
attttcaaatcgctcatcagtctgaaaacgcgtaacgccatcattttctctccgcacccg
cgtgcaaaagaagccaccaacaaagcggctgatatcgtgctgcaggctgccatcgcggcc
ggcgcgccgaaggacctgattggctggatcgatcagccgtctgtagaactgtctaacgcg
ctgatgcatcacccggacatcaacctgatcctggcgaccggtggtccaggcatggtgaaa
gcagcatacagctccggtaaacctgctatcggcgtcggcgccggtaacaccccggtagtc
attgatgaaaccgccgacatcaaacgtgccgtagcgtccgtactgatgtctaaaaccttc
gataacggcgtgatctgtgcttctgagcagtccgttgtggtggttgattcagtctatgac
gcggttcgcgaacgtttcgccagccacggcggctacctgctgcagggtaaagagctgaaa
gccgttcaggacattatcctgaaaaatggcgcgctgaacgcggctatcgttggtcagcca
gcggccaaaatcgctgaactggcaggcttcaccgtgccggccaccaccaaaattctgatt
ggtgaagtgaccaacgttgacgagagcgagccgtttgctcacgaaaaactgtctccgacg
ctggctatgtaccgtgcaaaagatttcgaagacgcggtagccaaagcagaaaaactggtc
gccatgggcggtatcggccacacctcttgcctgtacaccgaccaggacaaccagccggct
cgcgtggcttacttcggccaaatgatgaaaaccgcgcgtatcctgatcaacaccccggct
tctcagggtggtatcggtgacctgtacaacttcaaactcgcgccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgtcgtggctccctgccaatcgcactggatgaagtgattaccgatggtcacaaa
cgcgcgctgatcgtgactgaccgcttcctgttcaacaacggctatgccgatcagatcact
tccgtactgaaagctgcgggtgttgagacggaagtcttcttcgaagttgaagctgacccg
acgctgaccatcgtacgtaaaggtgccgacctggcgaactcctttaaaccagacgtgatc
atcgccctgggcggcggttccccgatggatgcggcgaaaatcatgtgggtcatgtacgaa
catccggaaacccacttcgaagaactggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtcaaagccaagatggtggcgatcactaccacttccggt
accggttctgaagttacgccgttcgccgtggtgaccgatgacgcgaccggtcagaaatac
ccgctggcagactacgcgctgaccccggatatggccattgtcgatgccaacctggtgatg
gatatgccgaaatcgctgtgtgcgttcggtggtctggatgcggtgactcacgccctggaa
gcttacgtttccgtactggcttctgagttctctgacggccaggcgctgcaggcgctgaaa
ctgctgaaagagtacctgccggcttcctatcacgaaggttccaagaacccggttgcccgt
gagcgcgtacacagtgccgcgactatcgccggtatcgcgttcgctaacgccttcctcggc
gtgtgtcactcgatggcgcacaaactgggctcccagttccatattccgcacggtctggcc
aacgccctgctgatctgcaacgttatccgctataacgcgaatgacaacccgaccaagcag
accgcgttcagccagtacgaccgtccgcaggctcgtcgtcgttacgctgaaatcgccgat
cacctgggcctctccgcaccaggcgaccgcaccgcagcgaaaatcgagaaactgctggca
tggctggaaagcattaaagctgagctgggtattccgaaatctatccgcgaagctggcgtt
caggaagctgacttcctggcccacgttgataaactgtctgaagatgcattcgatgaccag
tgcaccggcgctaacccgcgctacccgctgatctccgaactgaaacagatcctgctggat
acctactacggccgcgaatttgtcgaaggcgaagccggtgcgaaagccgaagttgctccg
gtaaaggctgagaaaaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system