KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_15630Help
Entry
KPN2242_15630     CDS       T01982                                 

Definition
GalU regulator GalF (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPN2242_15630
   00052 Galactose metabolism
    KPN2242_15630
   00500 Starch and sucrose metabolism
    KPN2242_15630
   00520 Amino sugar and nucleotide sugar metabolism
    KPN2242_15630
Enzymes [BR:kpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KPN2242_15630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3253552..3254442)
Genome map
AA seq 296 aa AA seqDB search
MANLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHSSK
NAVENHFDTSYELEALLEQRVKRQLLAEVQAICPPGVTIMNVRQAQPLGLGHSILCARPV
VGDNPFVVVLPDIILDGGTADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPMVAEGQVARIVEFIEKPDEPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQLTD
AIAELAKKQSVDAMLMTGESYDCGKKMGYMQAFVTYGMRNLKEGTKFRESIKKMLA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatttgaaagcggttattccggtcgcaggactaggcatgcatatgctgccggcc
acaaaggcaattccaaaggagatgctgccgatcgttgataagccaatgattcagtacatc
gttgacgaaatcgtcgccgccgggatcaaagagattgttctggtgacgcactcctcgaag
aacgcggtggaaaaccacttcgatacctcctacgagctggaagccctgctggaacagcgc
gtgaagcgccagctgctggcggaagtgcaggccatttgcccgccgggcgtgaccatcatg
aacgtgcgtcaggcgcagccgctgggcctgggccactccatcctctgcgcccgcccggta
gtcggcgacaacccgtttgtggtggtcctgccggatatcatccttgacggcggcaccgct
gacccgctgcgctataacctcgccgctatgatcgcccgctttaacgagaccggccgcagc
caggtgctggcgaaacgcatgccgggcgatctctccgaatactccgtcatccagaccaaa
gagccgatggtggctgaaggccaggtggcgcgtatcgtcgagtttattgaaaaaccggac
gagccgcagaccctggactccgatctgatggcggtggggcgctacgtgctgtcggcggat
atctgggccgaactggaacgtaccgagccgggcgcatggggccgtatccagctgaccgac
gccattgccgaactggcgaagaagcagtccgtcgacgcgatgctgatgaccggcgaaagc
tacgactgcgggaagaaaatgggctacatgcaggccttcgtcacctacgggatgcgtaac
ctgaaagaaggcaccaaattccgcgaaagtattaaaaaaatgctggcctga

DBGET integrated database retrieval system