KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_15935Help
Entry
KPN2242_15935     CDS       T01982                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kpo00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3329924..3331318)
Genome map
AA seq 464 aa AA seqDB search
MKTFPTDFLWGGATAANQVEGAYLEDGKGLSTSDVQPHGVFGEVVERVPGDSGIKDVAID
FYHRYPEDIALFAEMGFNCLRVSIAWTRIYPNGDDAEPNEAGLAFYDKLFDEMAKHNITP
LVTLSHYEMPWALVKNYGGWGSREVIGFFERYARTVFSRYKNKVKLWLTFNEINMSLHAP
MTGVGLPAGSSKGEVYQAIHHQLVASALAVKACHELVPEGKIGNMLLGGLMYPLSCKPED
VFETLQENRSWQFFGDVQARGAYPGYMQRYFRDNGITLTITDADREALKTTVDFISFSYY
MTGCVTADEALNQQARGNILSMVPNPHLASSEWGWQIDPLGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKVEADGSINDDYRISYLNDHLVQAREAIDDGVELMGFTSWGPIDLVSASKAE
LSKRYGFIYVDRHDDGTGTLARSKKKSFGWYKEVIASRGASLKA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattcccgacggattttttatggggcggcgcgaccgcggccaatcaggtggaa
ggtgcttatctggaagatggcaaaggcttatccacctccgatgtgcagccgcacggcgtt
ttcggcgaagtggtcgagcgcgtacccggcgacagcggcataaaagatgtggcgatcgat
ttttaccatcgctatccggaagatatcgccctgtttgccgagatgggctttaactgcctg
cgagtctccatcgcctggacccgcatctaccccaacggcgacgatgccgagccgaacgaa
gccggcctcgccttctacgacaagctgttcgacgagatggcgaagcacaacatcaccccg
ctggtgacgctgtcgcattatgaaatgccatgggcgctggtaaaaaactacggcggctgg
ggcagccgggaggtgattggcttctttgagcgctacgcccggacggtgttcagccgctat
aaaaataaggtcaaactgtggctgacctttaacgaaatcaatatgtcgctgcatgccccg
atgaccggcgtcggcctgccggccggcagcagcaaaggcgaggtgtatcaggcgattcac
caccagctggtggccagcgcgctggcggtcaaagcctgtcatgagctggtgcctgagggc
aaaatcggcaatatgctgctcggcgggctgatgtatcccctgagctgcaaaccggaggat
gtgttcgagacgctgcaggagaaccgcagctggcagttcttcggcgacgtacaggcgcgc
ggcgcgtacccgggctatatgcagcgctatttccgtgacaacggcatcacgctcaccatc
accgacgccgatcgtgaagcgctaaaaaccaccgtcgactttatctccttcagctactac
atgaccggctgcgtcaccgccgacgaggcgctgaaccagcaggcgcgcggcaatattctc
agcatggtgccgaacccgcacctggcgagctcggagtggggctggcagatagacccgctg
ggcctgcgcacgctgctgaacgtgctgtgggatcgctaccagaagccgctgtttatcgtg
gaaaacggtctgggcgccaaagataaggtggaagccgacggcagcattaacgatgactac
cgcatcagttacctgaacgaccacctggtgcaggcgcgggaagccattgacgatggcgtt
gagctgatgggctttaccagctggggaccgattgacctggtgagcgcctcaaaggcggag
ctgtcgaagcgctacggctttatctatgtcgaccgccatgatgacggtaccggcaccctg
gcgcgcagtaagaagaagagctttggctggtataaagaggtgattgccagccgcggcgcc
agcctgaaagcctaa

DBGET integrated database retrieval system