KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_17090Help
Entry
KPN2242_17090     CDS       T01982                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00300  Lysine biosynthesis
kpo01100  Metabolic pathways
kpo01120  Microbial metabolism in diverse environments
kpo01230  Biosynthesis of amino acids
Module
kpo_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    KPN2242_17090
Enzymes [BR:kpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     KPN2242_17090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AEJ99308
Position
3590782..3591909
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELAQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEPMDFGDTQNFWAWRGHGET
LAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQYPN
HRGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEPSSTEVVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPMLAELVNIEWDKGNEFFPPTSMQIANVQSGT
GSNNVIPGDMFVQFNFRFSTELTDEMIKSRVIALLEKYQLRYSVEWWLSGQPFLTGRGKL
VDAVVNAIEHYNEIKPQLLTNGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRVMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgcccggtcattgagctggctcagcagcttattcgccgcccttcccttagcccc
gatgatgcgggatgccaggcgttaatgattgaacgcctgcgtgcgatcggctttaccgtt
gaaccgatggatttcggcgatacgcagaatttctgggcctggcgcggccacggcgagacg
ctggccttcgccggccacaccgacgtagtcccggcaggcgacgccgaccgctggatcaat
cccccgttcgaaccgaccatccgcgacgggatgctgtttggccgcggagcggcggatatg
aaaggctcgctggcggcgatggtggttgccgcagagcgttttgtcgcgcagtacccgaac
cacaggggccgactggcgtttttgatcacctctgatgaagaggccagcgccaaaaacggc
accgtcaaagtggtggagacgctgatggcgcgtaacgagcgtctggactattgtctggtc
ggcgaaccttccagtaccgaagtggtcggcgatgtggtgaaaaacggccgccgcggctcg
ctgacctgcaacctgactattcacggcgtgcagggccatgtcgcctatccgcaccttgcc
gataaccctgtccaccgcgcggcgccgatgctggcggaactggtcaatatcgagtgggat
aaaggcaatgagttcttcccgccgaccagcatgcagatcgccaacgtgcagtccggcacc
ggcagcaataacgtgatccccggcgatatgttcgtccagttcaacttccgcttcagtacg
gagctgacggacgagatgatcaaatcccgggtgatcgccctgctggaaaaataccagctg
cgttacagcgtggagtggtggctctccggccagccgttcctcaccggacggggcaagctg
gtggatgcggtcgtcaacgcgattgagcactataatgagatcaaaccgcagctgttaacc
aacggcggcacctcagacggacggtttatcgcgcgcatgggggcgcaggtggttgagctg
ggccccgtaaacgcaacgattcacaaaattaatgaatgtgtgaacgccgccgacctgcag
ctgctggcgcggatgtatcaacgcgtcatggaacagctggtcgcctga

DBGET integrated database retrieval system