KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_17175Help
Entry
KPN2242_17175     CDS       T01982                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN2242_17175 (celA)
Enzymes [BR:kpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     KPN2242_17175 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3607261..3608694)
Genome map
AA seq 477 aa AA seqDB search
MSGFKAGFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGAHGVPREITDGVVAGKNYPNH
EAIDFYHRYPQDLALFAEMGFKCFRTSIAWTRIFPQGDELEPNEAGLQFYDDLFDECLKH
GIEPVITLSHFEMPYHLVTEYGGWRNRKLIDFFVRFARVVFTRYQHKVKYWMTFNEINNQ
ANFHEDFAPFTNSGLKYLPDEDREPVMYQAAHYELVASALAVKAAREINPALQIGCMIAM
CPIYPLTCAPDDMMMAMNAMHRRYWFTDVHVRGRYPQHLLNYFARRGFTLDITEADRQAL
TEGCVDYIGFSYYMSFATKATEDNPLLDYDETTSLVSNPYVKKSDWGWQIDPVGLRYSLN
WFWDHYQLPLFIVENGFGAIDVREADGSVNDQYRIDYLSAHIAEMKKAVVEDGVDLMGYT
PWGCIDLVSAGTGEMKKRYGFIYVDKDNEGNGTLARSRKKSFAWYQQVIASNGENLS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtccggatttaaagcaggttttctgtggggcggcgcggtcgcagcgcatcagttagag
ggcggctggcaggagggcggcaaggggatcagcgtggcggatgtgatgaccgccggcgcc
cacggcgtgccgcgggaaattaccgacggcgtggtggccgggaaaaactacccgaaccat
gaggcgatcgatttttatcatcgttatccacaagacctggcgctgtttgccgagatgggc
ttcaaatgttttcgcacctcgattgcctggacgcgtattttcccgcagggcgatgagctg
gagcccaacgaggctggcctgcagttttatgatgatctgttcgacgaatgcctgaaacac
ggcattgagccagtcattacgctgtcgcattttgaaatgccttatcacctggtcaccgag
tacggcggctggcgcaaccgcaagctaatcgactttttcgtgcgctttgccagggtcgtc
ttcacccgctatcaacataaagtgaagtactggatgacctttaacgagatcaacaaccag
gccaacttccatgaggactttgctcccttcaccaactccggtttgaaatatttgccggat
gaagaccgggaaccggtgatgtaccaggccgcgcactatgagctggtggccagcgccctg
gcggtgaaagcggcgcgcgagatcaacccggcgctgcagattggctgcatgatcgctatg
tgccccatctatccgctgacctgcgccccggacgatatgatgatggcgatgaacgccatg
caccgccgttactggtttaccgacgtccacgtgcgcggtcgctatccgcagcatctgctc
aactattttgcccgccgcggctttactctggatatcaccgaagccgatcgtcaggcgtta
accgagggctgtgtcgactacattggctttagctactatatgtcgttcgctaccaaagcc
accgaagacaaccccttgcttgattatgatgaaaccaccagcctggtctccaacccgtac
gtcaaaaagtcggactggggctggcagattgacccggtcggcctgcgctattcgctgaac
tggttctgggatcactaccagctgccgctgtttattgtcgaaaacggctttggcgcgatt
gatgtccgcgaagcggacggcagcgtcaatgaccagtatcgtatcgattatctctccgct
catatcgcggagatgaaaaaggcggtggtcgaggatggcgtcgatctgatgggctacacc
ccctggggctgtatcgatctggtttccgccggcacgggggaaatgaaaaaacgctacggc
tttatttatgtcgataaagataatgaaggcaatggcacgttggcacgcagccggaaaaag
tcgtttgcctggtatcagcaggtaattgccagcaacggggagaacctgtcgtag

DBGET integrated database retrieval system