KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_17845Help
Entry
KPN2242_17845     CDS       T01982                                 

Definition
hypothetical protein
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KPN2242_17845
Enzymes [BR:kpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     KPN2242_17845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3762529..3763479
Genome map
AA seq 316 aa AA seqDB search
MDNLFHQPQGGNEMPRFAGRATMMRLPFIEDLQGLDAAFVGIPLDIGTSQRSGTRYGPRY
IRAESVMIRPYNMATGAAPFDSLSVADIGDVPINTYSLLKSVQIIEDYYTGLNSYPLIPL
TLGGDHTITLPILRALTKKHGPVGLIHVDAHTDTNDEMFGEKIAHGTTFRRAVEEGLLDL
KRVVQIGQRAQGYAAGDFQWGVDQGFRLVQAEQCWHTSLAPLMAEVRQQMGDGPVYLSFD
IDSLDPIWAPGTGTPEVGGLTSIQALEIVRGCRGLNLIGADLVEVSPPYDVSGNTSQLAA
NLLYEMLCVLPGVKYA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggataacctctttcaccaaccgcagggtggcaatgagatgccacgcttcgccggccgc
gccacaatgatgcgcctgccgtttattgaagatttacagggacttgacgcggcgtttgtc
ggcattccgctggatatcggcacctcgcagcgctcgggcacgcgctacggaccacgctat
attcgcgccgaatcggtgatgatccgtccgtacaatatggcgaccggcgccgcgccgttc
gactcgctgtcggtggctgatatcggcgatgtgccgatcaatacctacagcctgctcaaa
tcggtgcaaattatcgaagattactacaccggtttgaatagttatccgctgatcccgctg
accctcggcggggaccacaccattaccctgccgatcctgcgggcgctgaccaaaaaacat
ggtccggtggggctcatccacgtcgacgcccataccgacaccaatgatgagatgttcgga
gagaaaatcgcccacggcaccaccttccgccgcgccgtagaggagggactgctcgacctc
aaacgggtggtgcagattggccagcgcgcccagggctatgccgccggcgacttccagtgg
ggcgttgaccagggatttcgcctggtgcaggcggagcagtgctggcatacctcgctggcg
ccgctgatggccgaagtccgccagcagatgggcgacgggccggtgtatctcagctttgat
atcgatagcctcgatcccatctgggctccaggaaccgggacgccggaagttggcggtctg
acctccattcaggcgctggagatcgtccgcggctgccgcggcctaaatctgattggcgcc
gatctggtcgaggtctcgcccccctacgacgtgagcggtaatacctcccagctggcggcc
aacctgctgtacgagatgctctgcgtcctgcccggcgtgaagtacgcctga

DBGET integrated database retrieval system