KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_17845Help
Entry
KPN2242_17845     CDS       T01982                                 

Definition
hypothetical protein
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:kpo00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3762529..3763479
Genome map
AA seq 316 aa AA seqDB search
MDNLFHQPQGGNEMPRFAGRATMMRLPFIEDLQGLDAAFVGIPLDIGTSQRSGTRYGPRY
IRAESVMIRPYNMATGAAPFDSLSVADIGDVPINTYSLLKSVQIIEDYYTGLNSYPLIPL
TLGGDHTITLPILRALTKKHGPVGLIHVDAHTDTNDEMFGEKIAHGTTFRRAVEEGLLDL
KRVVQIGQRAQGYAAGDFQWGVDQGFRLVQAEQCWHTSLAPLMAEVRQQMGDGPVYLSFD
IDSLDPIWAPGTGTPEVGGLTSIQALEIVRGCRGLNLIGADLVEVSPPYDVSGNTSQLAA
NLLYEMLCVLPGVKYA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggataacctctttcaccaaccgcagggtggcaatgagatgccacgcttcgccggccgc
gccacaatgatgcgcctgccgtttattgaagatttacagggacttgacgcggcgtttgtc
ggcattccgctggatatcggcacctcgcagcgctcgggcacgcgctacggaccacgctat
attcgcgccgaatcggtgatgatccgtccgtacaatatggcgaccggcgccgcgccgttc
gactcgctgtcggtggctgatatcggcgatgtgccgatcaatacctacagcctgctcaaa
tcggtgcaaattatcgaagattactacaccggtttgaatagttatccgctgatcccgctg
accctcggcggggaccacaccattaccctgccgatcctgcgggcgctgaccaaaaaacat
ggtccggtggggctcatccacgtcgacgcccataccgacaccaatgatgagatgttcgga
gagaaaatcgcccacggcaccaccttccgccgcgccgtagaggagggactgctcgacctc
aaacgggtggtgcagattggccagcgcgcccagggctatgccgccggcgacttccagtgg
ggcgttgaccagggatttcgcctggtgcaggcggagcagtgctggcatacctcgctggcg
ccgctgatggccgaagtccgccagcagatgggcgacgggccggtgtatctcagctttgat
atcgatagcctcgatcccatctgggctccaggaaccgggacgccggaagttggcggtctg
acctccattcaggcgctggagatcgtccgcggctgccgcggcctaaatctgattggcgcc
gatctggtcgaggtctcgcccccctacgacgtgagcggtaatacctcccagctggcggcc
aacctgctgtacgagatgctctgcgtcctgcccggcgtgaagtacgcctga

DBGET integrated database retrieval system