KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_22010Help
Entry
KPN2242_22010     CDS       T01982                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPN2242_22010
Enzymes [BR:kpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     KPN2242_22010
Exosome [BR:kpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPN2242_22010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4613591..4615777)
Genome map
AA seq 728 aa AA seqDB search
MSNHIDRDVINALIAGHFADPFSVLGMHRTDAGLEVRALLPDATDVWVIEPKTGRKVGKL
ECLDSRGFFSGVLPRRKNAFRYQLAVTWHGQQNLIDDPYRFGPLLQDLDVWLLSEGTHLR
PYETLGAHAATMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRFRKESGIWELFVP
GAHNGQLYKFELIDAHGNLRVKADPYAFESQMRPESASLICDLPPKVEQPADRRAANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFINAAHAAGLNVILDWVPGHFPADDFALASFDGTSLYEHS
DPREGYHQDWNTLIYNYGRREVSNYLVGNALYWIERFGIDALRVDAVASMIYRDYSRKAG
EWIPNEYGGRENLEAIEFLRNTNRILGEQTPGAVTMAEESTDFAGVTRPPAGGGLGFWFK
WNLGWMHDTLDYMKLDPVHRRYHHDKMTFGMLYNYTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWLFAFPGKKLLFMGNEFAQGREWNHDVSLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDPYGFEWLVVDDHERSVFVFVRRDRAGNEIIVASNFTPV
PRHDYRFGINQPGRWREALNTDSMHYHGSNQGNGGVVESDAIASHGREHSLSLTLPPLAT
IWLVREAQ
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcatattgatagagacgtgattaatgcgctaatcgccggtcatttcgcggat
cccttttccgtgctcggcatgcaccgtactgacgccgggctggaagtgcgcgcattatta
cccgatgccaccgacgtgtgggttattgaaccgaaaaccggacgcaaagtcggcaagctc
gaatgtctcgactcgcgtggtttcttcagcggcgtcctgccgcggcgtaaaaacgctttt
cgctatcagctggccgtcacctggcacgggcagcagaatctgatcgatgacccttatcgc
tttggtccgctgttgcaggaccttgacgtctggctgctgtcggaagggacccacctgcgc
ccttacgaaacgctgggcgcgcacgctgccaccatggacggcgtcaccggtacccgtttc
tcggtgtgggcgccgaacgcccgccgcgtatcggtggtggggcagtttaactactgggat
ggccgtcgccacccgatgcgattccgcaaagagtccgggatctgggagctgttcgttccc
ggcgcgcacaatggccagctgtataaattcgaactgattgacgcccacggcaatctgcgg
gtcaaagccgacccttacgcctttgagtcgcaaatgcgtccggaaagcgcctcgcttatc
tgcgatctgccgcccaaagtggaacagccagcggaccgtagagcggcgaaccagtttgat
gccccgatctctatctatgaagtgcatctcggctcctggcgccgtcataccgataataat
ttctggctgagctaccgcgagctggccgaccagctggtgccctatgcgaaatggatgggc
ttcacccatctcgaactattgccggttaacgagcacccgttcgacggcagctggggctat
caacccaccgggctctatgcgccgacccgccgcttcggcacccgcgacgatttccgttac
tttatcaatgccgcgcacgccgccgggctgaacgtcattcttgactgggtgcccggccac
ttcccggcggatgattttgcccttgcctcgtttgacggcacttcgctgtatgagcacagc
gatccgcgcgaggggtatcaccaggactggaataccctgatctacaactacggacgtcgg
gaagtcagcaactacctggtgggtaacgcgctgtactggatcgaacgcttcggcatcgat
gcgctgcgggtcgacgcggtggcctcgatgatctatcgcgattacagccgcaaggcggga
gagtggatccccaacgaatacggcggtcgggagaatctggaagccattgagtttttgcgc
aacaccaaccgcatccttggcgaacagacgccgggcgcggtcaccatggcggaagagtcc
accgattttgccggggtgacccgtccgccagccggcggcggcctcggtttctggttcaaa
tggaacctcggctggatgcacgacaccctggattacatgaagctcgatccggtgcatcgc
cgctaccatcatgacaaaatgaccttcggcatgctctacaactacaccgagaattttgtg
ctgccgctctcccacgatgaagtggtgcacggcaaaaaatcgattctcgaccgcatgccg
ggcgatgcctggcagaagttcgccaacctgcgcgcctactacggctggctgttcgccttc
ccggggaaaaagctgctgtttatgggcaatgagttcgctcagggccgcgagtggaaccat
gacgttagcctcgactggcatctgctggagggcggcgacaactggcaccacggcgtccag
cggctggtgcgcgacctgaaccatacctaccgtcatcataaagcgctgcacgagctggat
tttgacccctacggcttcgaatggctggtggtcgacgaccatgagcgctcggtgtttgtc
tttgtacgccgtgaccgggcgggcaacgagattatcgtcgccagcaacttcacgccggtg
ccgcgccacgactaccgcttcggcattaaccagccgggccgctggcgcgaggcgctaaat
accgactccatgcactatcacggcagcaatcagggcaatggcggcgtggtggaaagcgac
gctatcgccagccatggccgcgaacattcgctgtcgctgaccctgcccccgctggcgacg
atctggctggtccgggaggcgcaatga

DBGET integrated database retrieval system