KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_22425Help
Entry
KPN2242_22425     CDS       T01982                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kpo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4707581..4708690)
Genome map
AA seq 369 aa AA seqDB search
MMKVLCGAVLSALLLAAGQVGAACQWPAWEQFKQAYVSPEGRVIDPSDARKISTSEGQSY
GLFFALAANDRAGFDKLLTWTQNNLAEGDLKQHLPGWLWGKKDDEQWTLLDSNSASDSDL
WIAWALLEAGRLWQQPQYTETGKALLARIVAEETVAVPGLGTMLLPGKVGFADDSGWRFN
PSYLPPQLATYFVRFGAPWPALRDSNLRLLLETAPKGFTPDWVRYEKGKGWQLKTEKPPI
GSYDAIRVYLWVGMLHDGDKQKARLLQRFAPMAAQTTEHGVPPEKVNIVTGKTSGQGPVG
FSAAMLPFLQDDEARSVQRQRVADNYPGADAYYSAVLTLFGQGWDQHRFRFTASGELQPD
WNQECASSH
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagtactttgtggcgcggtgctctcggcgctgctgctggcggcgggccaggtg
ggcgccgcctgccagtggcccgcctgggagcagtttaaacaagcgtacgtcagccccgag
ggacgggtgattgaccccagcgatgcgcgcaaaatctccacctcggaaggacagagctat
ggcctgtttttcgccctggcggccaacgatcgcgcagggttcgacaaactgctgacctgg
acgcagaacaacctggcggaaggcgatctgaaacaacatttgccgggctggctgtggggc
aaaaaggacgatgagcagtggaccctgctggacagcaactcggcgtccgactcggatctg
tggatagcctgggcgctgctggaggcggggcgcctgtggcaacagccgcagtacaccgag
accggtaaagccctgctggcgcggattgtcgctgaagagacggtggcggtgccgggcctc
ggcacgatgctgctgccgggaaaagtcggttttgccgatgacagcggctggcggtttaac
cccagctatcttccgccgcagctggccacctactttgtgcgttttggcgcgccgtggccc
gctctgcgcgacagtaacctgcgcctgctgctggagaccgcgccgaaaggctttaccccg
gactgggtgcgctatgagaaagggaaaggctggcagctgaaaaccgaaaagccgccgatc
ggcagctatgacgcgattcgcgtctacctgtgggtgggcatgctccatgatggcgataag
cagaaagcgcgtctgctgcaacgcttcgcgccgatggcggcgcagaccacggagcatggg
gtacccccggagaaagtgaatatcgtcaccggcaaaaccagcggtcaggggccagtgggc
ttctccgcggcaatgctgccgtttttacaggacgacgaggcccggtcggtgcaacgccag
cgcgtcgccgataactatcccggcgcggatgcctactacagcgcagttctgacgctgttc
ggccagggttgggatcaacaccgttttcgtttcacggcgagtggcgaattacaacctgac
tggaaccaggaatgcgcaagctcacactaa

DBGET integrated database retrieval system