KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_22945Help
Entry
KPN2242_22945     CDS       T01982                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:kpo03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4824148..4824957)
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDVPVLSVRRRAKYLL
LELPDGWIIVHLGMSGSLRILSEELPAEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTRTL
EGHPVLAHLGPEPLSDAFNADYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFSAG
IHPDRLASSLSREECEQLVKVIKLVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRICGTPVVGTKHAQRATFYCRQCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccagaggttgaaaccagccgccgcggcatcgagccgcacctggttggc
gcaaccattctgcacgccgtcgtgcgcaacggacggctgcgctggccggtttccgaagag
atttatcgcctgagcgacgttccggttctcagcgtgcgtcgccgcgccaaatacctgctt
ctggagctgccggacggctggatcatcgtccatcttgggatgtcggggagcctgcgcatc
ctgagcgaagagctgcctgctgaaaaacacgatcacgttgacctggtcatgagtaacggc
aaggtgttgcgctacaccgatccacgccgctttggcgcctggttgtggaccagaacgctg
gaaggccatccggtactggcgcatcttggcccggagccgctcagcgacgcgttcaacgcc
gactatctccagcaaaaatgcgcgaagaagaaaaccgcgatcaaaccctggctgatggat
aacaagctggtggtgggcgtggggaatatctacgccagtgaatcgctgttctccgccggg
atccatcctgaccggctggcgtcctcgctgtcgcgggaagagtgtgagcagctggtgaag
gtgattaagctggtcctgctgcgttcgatagagcagggcggcaccacgttaaaggatttc
ctgcaaagcgatggcaagccgggctacttcgcccaggagctacaggtctatggccgcaag
ggcgaaccctgccggatctgcggcacgccggtcgtcgggaccaaacatgcccagcgggcg
accttttattgccgtcagtgccagaagtag

DBGET integrated database retrieval system