KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_23095Help
Entry
KPN2242_23095     CDS       T01982                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPN2242_23095 (tpiA)
   01230 Biosynthesis of amino acids
    KPN2242_23095 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN2242_23095 (tpiA)
   00051 Fructose and mannose metabolism
    KPN2242_23095 (tpiA)
   00562 Inositol phosphate metabolism
    KPN2242_23095 (tpiA)
Enzymes [BR:kpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KPN2242_23095 (tpiA)
Exosome [BR:kpo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KPN2242_23095 (tpiA)
  Exosomal proteins of bladder cancer cells
   KPN2242_23095 (tpiA)
  Exosomal proteins of melanoma cells
   KPN2242_23095 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4853104..4853871
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRTELAGVSGCAVAIAPPEMYLDLAKRAAEGSHIH
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNAGNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggttgcgaacctgcgtaccgagctggctggcgtaagcggctgtgcagttgccatc
gccccgccggaaatgtatctggacctggctaagcgcgcggcagaaggcagccacattcac
ctgggcgcgcagaacgttgacgtgaacctgtccggcgcattcaccggtgaaacctccgcc
gaaatgctgaaagatatcggcgcgcagtacatcatcatcggccactccgagcgtcgtacc
taccacaaagaatccgacgagctgatcgcgaagaaattcgcggtgctgaaagagcagggt
ctgaccccggttctgtgcatcggtgaaaccgaagccgaaaacgaagcgggcaaaacggaa
gaagtttgcgcacgtcagatcgacgccgtgctgaaaacccagggcgctgccgctttcgaa
ggcgtggttatcgcttacgaaccagtatgggctatcggtaccggcaaatcagcgaccccg
gctcaggcgcaggcggtgcacaaattcatccgtgaccacattgctaaagctgacgccaaa
atcgctgagcaagtgatcatccagtacggcggttccgttaacgctggcaacgccgcagag
ctgttcacccagccggacatcgacggcgcgctggttggcggcgcctccctgaaagctgac
gctttcgcggtgatcgttaaagcagcagaagcagcgaaaaaagcgtaa

DBGET integrated database retrieval system