KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_23095Help
Entry
KPN2242_23095     CDS       T01982                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00010  Glycolysis / Gluconeogenesis
kpo00051  Fructose and mannose metabolism
kpo00562  Inositol phosphate metabolism
kpo01100  Metabolic pathways
kpo01110  Biosynthesis of secondary metabolites
kpo01120  Microbial metabolism in diverse environments
kpo01130  Biosynthesis of antibiotics
kpo01200  Carbon metabolism
kpo01230  Biosynthesis of amino acids
Module
kpo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kpo_M00002  Glycolysis, core module involving three-carbon compounds
kpo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN2242_23095 (tpiA)
   00051 Fructose and mannose metabolism
    KPN2242_23095 (tpiA)
   00562 Inositol phosphate metabolism
    KPN2242_23095 (tpiA)
Enzymes [BR:kpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KPN2242_23095 (tpiA)
Exosome [BR:kpo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KPN2242_23095 (tpiA)
  Exosomal proteins of bladder cancer cells
   KPN2242_23095 (tpiA)
  Exosomal proteins of melanoma cells
   KPN2242_23095 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-ProteinID: AEK00495
Position
4853104..4853871
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRTELAGVSGCAVAIAPPEMYLDLAKRAAEGSHIH
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNAGNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggttgcgaacctgcgtaccgagctggctggcgtaagcggctgtgcagttgccatc
gccccgccggaaatgtatctggacctggctaagcgcgcggcagaaggcagccacattcac
ctgggcgcgcagaacgttgacgtgaacctgtccggcgcattcaccggtgaaacctccgcc
gaaatgctgaaagatatcggcgcgcagtacatcatcatcggccactccgagcgtcgtacc
taccacaaagaatccgacgagctgatcgcgaagaaattcgcggtgctgaaagagcagggt
ctgaccccggttctgtgcatcggtgaaaccgaagccgaaaacgaagcgggcaaaacggaa
gaagtttgcgcacgtcagatcgacgccgtgctgaaaacccagggcgctgccgctttcgaa
ggcgtggttatcgcttacgaaccagtatgggctatcggtaccggcaaatcagcgaccccg
gctcaggcgcaggcggtgcacaaattcatccgtgaccacattgctaaagctgacgccaaa
atcgctgagcaagtgatcatccagtacggcggttccgttaacgctggcaacgccgcagag
ctgttcacccagccggacatcgacggcgcgctggttggcggcgcctccctgaaagctgac
gctttcgcggtgatcgttaaagcagcagaagcagcgaaaaaagcgtaa

DBGET integrated database retrieval system