KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_23125Help
Entry
KPN2242_23125     CDS       T01982                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    KPN2242_23125
Enzymes [BR:kpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     KPN2242_23125
Exosome [BR:kpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPN2242_23125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4858968..4860479
Genome map
AA seq 503 aa AA seqDB search
MTDKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPKPGWVEHDPMEIWASQSST
LVEALAKADINSDQIAAIGITNQRETVVVWERETGKPIYNAIVWQCRRTAEICEQLKRDG
MEEYIRKATGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHDLDWDDKMLDALDIPRAMLPEVRKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVTSTHGLLTTIACGPRGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAFQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NYRYSGWKKAVKRALAWEEHDEA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaaaaaatatatcgttgcgcttgaccagggcactaccagctcccgggccgtt
gtgatggatcatgatgccaatatcgtcagcgtctcccagcgagaatttgaacaaatttat
cctaagccaggctgggtcgaacacgacccgatggaaatctgggcttcccaaagctcgacg
ctggtcgaagcgctggccaaagcggatatcaactccgatcagatcgcggccatcggcatc
accaatcagcgtgagaccgtggtggtgtgggagcgagagaccggtaaacccatctacaac
gctatcgtctggcagtgccgccgtaccgcggagatctgcgagcagctcaagcgtgacggg
atggaagagtatatccgcaaggccacaggcctggtggtggacccgtacttctccggcacc
aaggtgaaatggatcctcgaccatgtcgaaggttcccgtgagcgtgcgaagcgcggcgag
ctgctgttcggcaccgttgatacctggcttatctggaagatgacccagggccgcgtgcac
gtcaccgactacaccaacgcctcgcgtaccatgctgttcaacatccacgacctcgactgg
gacgacaagatgctcgacgcgctggacattccgcgcgccatgctgccggaagtgcgcaag
tcttccgaagtgtacggccagaccaacatcggtggtaaaggcgggacccgtattcctatc
gccgggatcgccggtgaccagcaggcggccctgttcggccagctgtgcgtcaaagaaggg
atggcgaaaaacacctacggcaccggctgctttatgctgatgaataccggcgaaaaagcg
gtcacctccacccacggtctgctgaccaccatcgcctgcggcccgcgcggcgaggtgaac
tacgctctggaaggggcggtgtttatggccggcgcgtctattcagtggctgcgcgacgag
atgaagctcatcagcgatgccttcgactccgagtacttcgccaccaaagtgaaggatacc
aacggcgtgtacgtggtacccgcgttcaccggtcttggcgcaccgtactgggacccgtat
gcccgcggcgcgattttcggcctcacccgcggcgtgaactccaaccacattatccgtgcg
acgctggagtccatcgcctttcagacccgcgacgtgctggaggcgatgcaggctgactct
ggcattcgtctgcacgccctgcgcgtagacggcggcgcggtggctaacaacttcctgatg
cagttccagtccgatatcctcggcacccgtgtcgagcgtccggaagtacgcgaagtgacg
gcgctgggcgcggcctatctggccggtctggcggtcggtttctggcagaatctggatgaa
ctgcaggagaaagcggtgattgagcgcgaattccgcccgggtattgaaactactgagcgt
aactatcgttacagcggctggaagaaagcggtgaaacgcgcgttagcgtgggaagagcac
gacgaagcgtaa

DBGET integrated database retrieval system