KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_23845Help
Entry
KPN2242_23845     CDS       T01982                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KPN2242_23845
Enzymes [BR:kpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     KPN2242_23845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5008702..5009631
Genome map
AA seq 309 aa AA seqDB search
MKTAGKLVVLGSINADHILNLDAFPTPGETVTGHHYQVAFGGKGANQAVAAGRSGADIAF
IACTGDDDIGERIRRQLASDKIDVAPVRAVAGEATGVALIFVNAEGENVIGIHAGANAAL
SVSQVEAEKERIASAQALLMQLESPLESVIAAAKIAHHHHTTVVLNPAPARELPDELLAL
VDIITPNETEAEKLTGIRVESDEDAAKAANVLHAKGIGTVMITLGSRGVWLSAEGESRRI
PGFRVQAIDTIAAGDTFNGALVTALLEGTALPEAIRFAHAAAAIAVTRKGAQPSVPWRTE
IDEFLAQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgcaggcaaacttgtcgtccttggcagtatcaatgccgatcacattcttaac
cttgacgctttcccgacgccgggcgaaaccgtcaccggccaccattatcaggtggcgttc
ggtggaaaaggggccaaccaggcggtggccgccgggcgcagcggagcggatatcgcgttt
atcgcctgcaccggcgatgacgatatcggtgaacgcatccgtcgtcagctggcgagcgat
aaaatcgacgtggcgcccgtgcgcgcggttgccggggaagcgaccggggtggcattaatt
ttcgttaacgccgaaggtgagaatgtcatcggtattcatgccggcgccaatgcggcgctt
tccgtctcccaggttgaggcggaaaaagagcgtatcgccagcgcacaggcgttgttgatg
cagctggagtcgccgctggagagcgtcatagcggcggcgaaaatcgcccatcaccatcac
accaccgtggtgctgaaccccgcgccagcgcgtgagctaccggatgaactgctggcgctg
gtggatattattacccctaacgaaaccgaagcggaaaagctgaccggtattcgcgttgag
agtgacgaagatgcggcaaaagccgccaacgtgctgcatgccaaaggcattggtacggtg
atgatcaccctcggcagccgcggcgtctggctcagtgccgaaggcgaaagccgccggatc
ccagggtttcgcgtacaggccattgatactatcgcggccggtgatacctttaacggcgcg
ctggtgaccgcgctgctggaagggaccgccctgccggaggcgattcgctttgcgcatgcc
gcagcggcgatcgccgtaacccgcaaaggcgctcagccgtccgtgccttggcgcacagag
atcgatgaatttttagcgcaacaggggtaa

DBGET integrated database retrieval system