KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_24160Help
Entry
KPN2242_24160     CDS       T01982                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPN2242_24160
   01230 Biosynthesis of amino acids
    KPN2242_24160
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN2242_24160
   00030 Pentose phosphate pathway
    KPN2242_24160
   00051 Fructose and mannose metabolism
    KPN2242_24160
   00052 Galactose metabolism
    KPN2242_24160
  Energy metabolism
   00680 Methane metabolism
    KPN2242_24160
Enzymes [BR:kpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KPN2242_24160
Protein phosphatases and associated proteins [BR:kpo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KPN2242_24160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5078071..5079033
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFREEHIRAVAIENMKKRGLDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFIMVPEVEYTRDDLVAEIKAGIAKGKKHAIVAITEHMCDVDELASYIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIELLLQGHGGRCVGIQNEKLVHHDIIDA
IENMKRPFKNDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagtggcggtgatgcgccgggcatgaacgcagca
attcgtggcgttgtgcgcgcggcattaacggaaggtctggaagtttttggaatctatgac
ggttacctcggattgtatgaagaccgtatggttcagctcgaccgttacagcgtttccgac
atgatcaaccgcggcggcaccttcctgggctccgctcgcttcccggaattccgcgaagaa
cacatccgcgctgtggctatcgaaaacatgaagaagcgcggcctggacgcgctggtggtt
atcggcggtgacggttcctatatgggggcgatgcgcctgaccgagatgggcttcccatgc
atcggcctgccgggcactatcgacaacgatatcaaaggcactgactacaccatcggcttc
tttactgccctgagcaccgtggtggaagcgattgaccgtttgcgcgacacctcctcttcg
caccagcgtatctccgtggtggaagtgatgggccgttactgtggcgacctgaccctggcg
gcggcgattgccggcggctgtgagtttatcatggtgcctgaagtggaatatacccgtgac
gatctggtggcagaaatcaaagccggtatcgcgaaagggaaaaaacacgctatcgtggcc
atcaccgagcacatgtgcgacgttgacgagctggcaagctacatcgagaaagagactggc
cgtgaaactcgcgccaccgtcctcggccacattcagcgcggcggttccccggttccttac
gaccgcatcctggcttcccgcatgggcgcctatgcgattgagctgctgctacagggccat
ggcggccgttgcgtcggcatccagaacgagaagctggtgcaccacgacatcatcgatgcc
atcgagaacatgaagcgtccgttcaagaacgactggctggattgcgcgaagaaactgtac
taa

DBGET integrated database retrieval system