KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_24515Help
Entry
KPN2242_24515     CDS       T01982                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00860  Porphyrin and chlorophyll metabolism
kpo01100  Metabolic pathways
kpo01110  Biosynthesis of secondary metabolites
kpo01120  Microbial metabolism in diverse environments
Module
kpo_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KPN2242_24515 (hemD)
Enzymes [BR:kpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     KPN2242_24515 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEK00775
Position
complement(5164375..5165115)
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPLPQGEALVSRLRAMGRVAWSFPLIEFTPGRELPALGDALARLGPDDLLFALS
QHAVEFAHARLQLQGLPWPTSPRYFAIGRTTALALHTVSGQHIHYPLDREISEVLLQLPE
LQNIAGKNALILRGNGGRELLGATLTERGARVTFCECYQRSAKHYDGAEEAMRWQSRGVT
TLVVTSGEMLQQLWSLIPQWYREQWLLHCRVVVVSERLALQARELGWQEIQVADSADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctggtcactcgtccactaccgcaaggagaagcgctggtcagccgtctgcgg
gccatgggacgcgtggcctggagctttccgctgatagaatttacgcctggcagggagctt
cccgcgctgggcgatgcgcttgcccgactggggcccgacgatctgctatttgcgctatcc
cagcatgcggtggaattcgcccatgcccgtctgcagctgcagggcctgccctggcccact
tctccgcgctattttgccattggccgcacgacggcgctggccctgcatacggtcagtggg
cagcatatccattacccgttagatcgggaaattagcgaagtcttgctacaattacctgaa
ttacaaaacattgccgggaaaaatgcgctgatcctacgcggcaatggcgggcgggaactc
ttaggcgcgacgctgaccgagcgcggcgccagggtcacattttgtgaatgttatcaacgt
agtgcaaaacattacgatggcgcagaagaagcgatgcgctggcaatctcgcggagtcacc
acgctggtggtcaccagcggcgagatgctgcagcagctatggtcgttaataccgcaatgg
tatcgcgaacagtggctcctgcactgccgcgttgtcgttgtcagcgaacgtctggccctt
caggcccgggaactgggctggcaggagattcaggttgccgatagcgccgacaacgatgcg
ctgctacgcgcattacaataa

DBGET integrated database retrieval system