KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_24580Help
Entry
KPN2242_24580     CDS       T01982                                 

Definition
phospholipase A (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KPN2242_24580
   00565 Ether lipid metabolism
    KPN2242_24580
   00590 Arachidonic acid metabolism
    KPN2242_24580
   00591 Linoleic acid metabolism
    KPN2242_24580
   00592 alpha-Linolenic acid metabolism
    KPN2242_24580
Enzymes [BR:kpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     KPN2242_24580
    3.1.1.32  phospholipase A1
     KPN2242_24580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5177996..5178856
Genome map
AA seq 286 aa AA seqDB search
MRISLACLVALCALPAGVMAQDASVHDKPAVRGSIIANLLQDHDNPFLLYPYESNYLLYT
WTSDLNKEAIRSYDWAENARKDEVKFQLSLAFPLWRGILGDNSLLGASYTQKSWWQLSNS
KESAPFRETNYEPQLFLGFATDYQFAGWTLRDIEMGYNHDSNGRSDPTSRSWNRLYARLM
AQNGNWLVEVKPWYVVGNTDDNPDITKYMGYYRLKVGYQLGEAILSAQGQYNWNTGYGGA
ELGVSYPITKHVRAYTQIYSGYGESLIDYNFNQTRVGVGLMLNDLF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatctctttggcctgcctggtggcgctgtgcgcgctaccggccggtgttatggcg
caggacgcgtcggtacacgacaaaccggcagtgcgcggcagcattatcgccaacctgctc
caggaccatgataatcctttcctgctctacccttatgagagcaactatctgctctatacg
tggaccagcgacctcaataaagaggcgatccgcagctatgactgggccgaaaatgcccgt
aaagatgaagtgaagtttcagctaagcctggcgttcccgctgtggcgcggtatcctgggc
gataattcgctgctgggcgcgtcctatacccagaaatcctggtggcagctctctaacagc
aaagagtcggcgccgtttcgcgaaaccaattatgaaccccagctgtttttgggctttgcg
accgactaccagtttgccggctggacgctgcgcgatatcgagatggggtataaccacgac
tcgaatgggcgttccgaccccacctcgcgcagctggaatcggctttatgcccgcctgatg
gcgcaaaacggtaactggctggtggaagtgaagccctggtatgtggtgggcaacaccgat
gataacccggatatcaccaaatatatgggctattaccggctgaaggtgggctaccagctg
ggagaggcgatcctcagcgcgcaggggcaatacaactggaacaccggctacggcggggcg
gaacttggcgtgagctatcccattaccaaacatgttcgcgcctatacgcagatctacagc
ggctatggcgagtcgcttatcgactataactttaaccaaacgcgcgtcggcgtcgggcta
atgctcaacgatctgttttaa

DBGET integrated database retrieval system