KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_24605Help
Entry
KPN2242_24605     CDS       T01982                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:kpo00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5183290..5184282
Genome map
AA seq 330 aa AA seqDB search
MFGQKKDWETRENAFAAFSMGPLTDFWRQREEAEFKGVDDVPVRFVRFCAQHNDRLVLIC
PGRIESYVKYAEVAYDLFHCGFDVMIIDHRGQGRSGRLLSDTHRGHVVNFSDYVDDLAAL
WQQQVVPGHWRKRFILAHSMGGAIATLFLQRYRAHCDAIALCAPMFGIIIRLPDWMVRHI
LDWAEGHQRIREEYAIGTGRWRALPFAVNVLTHSRQRYRRNLRFYADEPRLQVGGPTWHW
VREGMLAGDEVLANVEKDTAPTLLLQAEEERVVDNLMHDRYCELRAAAGHPCEGGKPLVI
EGAYHEILFEKDAMRSVALNAIVEFFNRHT
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggcagaaaaaggactgggaaacacgagaaaacgcgtttgcggcctttagcatg
gggccgctgacggatttctggcgacagcgcgaagaagctgaatttaaaggcgtcgacgat
gtaccggtacgctttgtccgcttttgcgcgcaacataacgatcgtctggtgttgatttgc
cccgggcgcattgaaagctacgtgaagtatgctgaagtggcctacgatctctttcactgc
ggctttgatgtgatgatcattgaccatcgcgggcagggacgctcgggccgcctgctctca
gatacccaccgcggacacgtggttaacttcagcgactatgttgatgacctggccgcgctc
tggcagcagcaggtggttcctggacactggcgaaaacggtttatccttgcccattctatg
ggcggagcgattgccacgctttttctgcaacgttaccgggcgcattgcgatgcaatagcg
ctctgcgcgccgatgttcgggattatcattcggctgccggactggatggtgcgccatatt
ctcgactgggctgagggccatcagcgcattcgcgaagagtatgctatcggcaccgggcgc
tggcgggcgctgccttttgccgttaacgtgctgacgcacagtcggcaacgctatcgtcgc
aacctgcgcttctatgccgatgagccgcggctgcaggtcggcggtccgacctggcactgg
gtgcgtgagggcatgctggccggcgacgaagtgctggcgaatgtggaaaaagataccgcc
ccgacgctgcttttacaggcggaggaggagcgggtggtcgataatctgatgcacgaccgc
tattgcgaattacgggccgctgccggccatccttgtgagggcggtaaaccgctcgtcatt
gaaggggcatatcatgagatcctttttgaaaaggacgctatgcgctcagtcgcgctcaat
gccatcgtcgagtttttcaatcgacatacttaa

DBGET integrated database retrieval system