KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_24700Help
Entry
KPN2242_24700     CDS       T01982                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00071  Fatty acid degradation
kpo00280  Valine, leucine and isoleucine degradation
kpo00281  Geraniol degradation
kpo00310  Lysine degradation
kpo00362  Benzoate degradation
kpo00380  Tryptophan metabolism
kpo00410  beta-Alanine metabolism
kpo00640  Propanoate metabolism
kpo00650  Butanoate metabolism
kpo00903  Limonene and pinene degradation
kpo00930  Caprolactam degradation
kpo01040  Biosynthesis of unsaturated fatty acids
kpo01100  Metabolic pathways
kpo01110  Biosynthesis of secondary metabolites
kpo01120  Microbial metabolism in diverse environments
kpo01130  Biosynthesis of antibiotics
kpo01200  Carbon metabolism
kpo01212  Fatty acid metabolism
Module
kpo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KPN2242_24700 (fadB)
   00650 Butanoate metabolism
    KPN2242_24700 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    KPN2242_24700 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    KPN2242_24700 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPN2242_24700 (fadB)
   00310 Lysine degradation
    KPN2242_24700 (fadB)
   00380 Tryptophan metabolism
    KPN2242_24700 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPN2242_24700 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KPN2242_24700 (fadB)
   00281 Geraniol degradation
    KPN2242_24700 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPN2242_24700 (fadB)
   00930 Caprolactam degradation
    KPN2242_24700 (fadB)
Enzymes [BR:kpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KPN2242_24700 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KPN2242_24700 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     KPN2242_24700 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     KPN2242_24700 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AEK00812
Position
complement(5202748..5204937)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGHALDVLEKQSDLKGLLLRSE
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDVGADQALK
IGLVDGVVAAEKLRDGALAILRQAMNGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARLGREEALVLENKSFVPLAHTNEARALVGIFLNDQYVK
AKAKKLTKDVETPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDISDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIQPTLEYSGFDRVDVVVEAVVENPKVKKAVLAETESKVRP
DTVLASNTSTIPISELASVLQRPENFCGMHFFNPVHRMPLVEVIRGEKTSDNTIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKDDSKGKP
KKEEDAAVDSLLADVSQPKRDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTIGSAKYLDMAQQYQHLGPLYEVPAGLRDKARHNEAYYPQVEPA
RPVGALKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgccccaggttcggtcaacaagcttgataccgcaaccgtagccagcctcggt
catgcgctggacgtactggaaaaacaaagcgatctcaaaggtctgctgctgcgctctgaa
aaagcggcatttatcgtcggcgcggatatcaccgaattcctctcgctgttcctggtccct
gaggagcagttaagccagtggctgcattttgctaacagcgtcttcaatcgtctggaagat
ctccccgtccccacaatctctgccgtcaatggctatgcgctgggcggcggttgcgaatgc
gtgctggcgaccgattaccgcctggcgacgccggatctgcgcattgggctgccggaaacc
aagctcggcattatgcccggcttcggcggttccgtgcgtctgccgcgcctgctcggcgcc
gatagcgcgctggaaattattgccgccgggaaagacgtcggcgccgatcaagcactgaaa
atcggcctggtggatggcgtggtcgctgcggaaaaactacgcgacggcgcgctggcgatc
ctacgtcaggccatgaatggcgacctggactggaaagcgaaacgtcagccgaagctggag
ccgctgaagctcagcaaaattgaagccgccatgagcttcacgattgccaaaggcatggtc
gcgcaaaccgccgggaagcattacccggcgccgatcaccgcggtcaaaaccattgaagcc
gccgcgcgtcttggtcgtgaagaagccctggtgctggaaaataaaagctttgtcccgctg
gcccataccaatgaggcccgcgcgctggttggtatcttcctgaacgaccagtacgtcaaa
gcgaaagcgaaaaagctgaccaaagatgtcgagacgccgaagcatgctgccgtcctgggc
gctggcattatgggcggcggtatcgcttaccagtcggcctggaagggcgtgccggtggtg
atgaaagacatcagcgacaaatcgctgaccctgggtatgaccgaagcggcgaaactgctg
aataaacagctggaacgcggcaaaatcgacggtctgaagctggccggagtgattagcacc
attcagccaacgctggaatacagcggttttgaccgcgtggacgtcgtcgttgaagcggtg
gtggaaaacccgaaagtgaagaaagccgtactagcggaaaccgagtcaaaagtgcgcccg
gataccgtgctggcgtccaacacctcaacgatccccatcagcgagctggccagcgttctg
cagcgcccggaaaacttctgcggtatgcacttctttaacccggtgcatcgcatgccgctg
gttgaagtgatccgcggcgaaaaaacctcggataataccattgccaaagtggtggcctgg
gccagcaaaatgggcaaaacgccgattgtggtgaatgattgtcccggcttcttcgtcaac
cgggtactgttcccctacttcgccggcttcagccagctgctgcgcgacggggcggacttc
cgcaaagtcgacaaagtgatggagaaacagtttggctggccgatgggcccggcttatctg
ctggacgtggtcggcatcgataccgcgcaccatgctcaggcggtcatggcggcgggcttc
ccgcagcggatgcagaaagattatcgcgacgccatcgacgccctgtttgacgccaaccgt
ttcggccagaagaacggcctcggcttctggcgctataaagacgacagcaaaggtaagccg
aagaaagaagaagatgctgccgtcgacagcctgctggccgacgtcagccagccgaagcgc
gatttcagcgatgaagagattatcgcccgcatgatgatccccatggttaacgaagtcgtc
cgctgcctggaagaaggcattatcgccagcccggcggaagcggatatggcgctggtatac
ggcctgggcttccctccgttccacggcggcgcattccgctggctggacaccatcggcagc
gcgaagtatctcgatatggcgcagcaataccagcaccttggcccgctgtatgaagtgcca
gccggtctgcgtgacaaagcgcgccataacgaagcgtattatccccaggtagagccagcc
cgtccggttggcgctctgaaaacggcttaa

DBGET integrated database retrieval system