KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_25566Help
Entry
KPN2242_25566     CDS       T01982                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KPN2242_25566
Enzymes [BR:kpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     KPN2242_25566
Exosome [BR:kpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPN2242_25566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pKCTC2242:complement(81618..82640)
Genome map
AA seq 340 aa AA seqDB search
MSIIIPGSFPARRLRRSRTHSFSRRLVAENQLTVNDLILPVFIIEGQNLRQEVPSMPGVF
RLSVDMLLHDAAQFVQAGIPAIALFPCIESSAKSLMADASWDPSGLVPRTVRALKKAFPE
LGVITDVALDAYTSHGQDGIIDEHGYVLNEPTKEILTRQALTHAEAGADIVAPSDMMDGR
IGHIRQAFETNGLLTIQIMAYSAKYASNYYGPFREATQSAMALGKRDKKNYQMDPANAME
ALHEIAQDLQEGADMVMVKPGMPYLDIIREARKTFAVPVFAYQVSGEYAMHMAAFRHGWL
DEEQTVLESLICFKRAGADGILTYFASSVAQWLNQHQREY
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgagtattattattcctggttctttcccggcgcgacgactgcgtcgctctcgtacccat
tctttcagtcgccgtctggtcgctgaaaatcagctgaccgtaaacgacctgattttacct
gtattcattattgaggggcaaaacctgcggcaggaagtgccgtcgatgccgggtgtgttt
cgcctgtcggttgatatgttgcttcatgatgccgcgcaatttgttcaggcaggtatacct
gctattgcactgtttccgtgtatagaaagttctgctaaatcgctgatggcagacgcttcg
tgggatccatccggtttagtaccgcgaactgtaagggcgctgaaaaaggcttttcctgaa
ctcggggtgataactgacgttgcgcttgacgcctatacgtcacatggtcaggacggcatc
attgacgaacatggatatgtgcttaatgagccgacaaaagaaattctcaccagacaggcg
cttacgcacgctgaagcgggtgcagatattgtcgcgccaagcgacatgatggatggccgc
atcggacatatcagacaggcatttgaaacgaatggcctgctgactattcagatcatggca
tattcagcgaaatacgcgtcaaactattacggtccttttcgcgaagccactcaatctgcc
atggcgctgggcaaacgggacaaaaaaaactatcagatggacccggcaaatgcgatggaa
gcgttgcatgaaattgcccaggatttgcaggagggggcagacatggtgatggttaagccg
ggcatgccatatctggatattatcagggaagctaggaaaacttttgcagtacccgttttt
gcctaccaggtttccggtgagtatgcgatgcatatggccgcgttccggcatggctggctc
gacgaagagcaaacggtgcttgagtcacttatatgcttcaaacgcgccggggcagacggc
atattgacttactttgccagctcggtagctcagtggcttaatcaacatcaacgggaatat
tga

DBGET integrated database retrieval system