KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_0108Help
Entry
A79E_0108         CDS       T02213                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
kpp00010  Glycolysis / Gluconeogenesis
kpp00051  Fructose and mannose metabolism
kpp00562  Inositol phosphate metabolism
kpp01100  Metabolic pathways
kpp01110  Biosynthesis of secondary metabolites
kpp01120  Microbial metabolism in diverse environments
kpp01130  Biosynthesis of antibiotics
kpp01200  Carbon metabolism
kpp01230  Biosynthesis of amino acids
Module
kpp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kpp_M00002  Glycolysis, core module involving three-carbon compounds
kpp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A79E_0108
   00051 Fructose and mannose metabolism
    A79E_0108
   00562 Inositol phosphate metabolism
    A79E_0108
Enzymes [BR:kpp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     A79E_0108
Exosome [BR:kpp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   A79E_0108
  Exosomal proteins of bladder cancer cells
   A79E_0108
  Exosomal proteins of melanoma cells
   A79E_0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-ProteinID: AFQ63525
Position
complement(111882..112649)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRTELAGVSGCAVAIAPPEMYLDLAKRAAEGSHIH
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNAGNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggttgcgaacctgcgtaccgagctggctggcgtaagcggctgtgcagttgccatc
gccccgccggaaatgtatctggacctggctaagcgcgcggcagaaggcagccacattcac
ctgggcgcgcagaacgttgacgtgaacctgtccggcgcattcaccggtgaaacctccgcc
gaaatgctgaaagatatcggcgcgcagtacatcatcatcggccactccgagcgtcgtacc
taccacaaagaatccgacgagctgatcgcgaagaaattcgccgtgctgaaagagcagggt
ctgaccccggttctgtgcatcggtgaaaccgaagccgaaaacgaagcgggcaaaacggaa
gaagtttgcgcgcgtcagatcgacgccgtgctgaaaactcagggcgctgccgctttcgaa
ggcgtggttatcgcttacgaaccagtatgggctatcggtaccggcaaatcagcgaccccg
gctcaggcgcaggcggtgcacaaattcatccgtgaccacattgctaaagctgacgccaaa
atcgctgagcaagtgatcatccagtacggcggttccgttaacgctggcaacgccgcagag
ctgttcacccagccggacatcgacggcgcgctggttggcggcgcctccctgaaagctgac
gctttcgcggtgatcgttaaagcagcagaagcagcgaaaaaagcgtaa

DBGET integrated database retrieval system