KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_0138Help
Entry
A79E_0138         CDS       T02213                                 

Definition
(GenBank) Formamidopyrimidine-DNA glycosylase
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    A79E_0138
Enzymes [BR:kpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     A79E_0138
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     A79E_0138
DNA repair and recombination proteins [BR:kpp03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     A79E_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
140791..141600
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDVPVLSVRRRAKYLL
LELPDGWIIVHLGMSGSLRILSEELPAEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTRTL
EGHPVLAHLGPEPLSDAFNADYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFSAG
IHPDRLASSLSREECEQLVKVIKLVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRICGTPVVGTKHAQRATFYCRQCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccagaggttgaaaccagccgccgcggcatcgagccgcacctggttggc
gcaaccattctgcacgccgtcgtgcgcaacggacggctgcgctggccggtttccgaagag
atctatcgcctgagcgacgttccggttctcagcgtgcgtcgccgcgccaaatacctgctt
ctggagctgccggacggctggatcatcgtccatcttgggatgtcggggagcctgcgcatc
ctgagcgaagagctgcctgctgaaaaacacgatcacgttgacctggtcatgagtaacggc
aaggtgttgcgctacaccgatccacgccgctttggcgcctggttgtggaccagaacgctg
gaaggccatccggtactggcccatcttggcccggagccgctcagcgacgcgttcaacgcc
gactatctccagcaaaaatgcgcgaagaagaaaaccgcaatcaaaccctggctgatggat
aacaagctggtggtgggcgtggggaatatctacgccagtgaatcgctgttctccgccggg
atccatcctgaccggctggcgtcctcgctgtcgcgggaagagtgtgagcagctggtgaag
gtgattaagctggtcctgctgcgttcgatagagcagggcggcaccacgttaaaggatttc
ctgcaaagcgatggcaagccgggctatttcgcccaggagctacaggtctatggccgcaag
ggcgaaccctgccggatctgcggcacgccggtcgtcgggaccaaacatgcccagcgggcg
accttttattgccgtcagtgccagaagtag

DBGET integrated database retrieval system