KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_0138Help
Entry
A79E_0138         CDS       T02213                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:kpp03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
140791..141600
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDVPVLSVRRRAKYLL
LELPDGWIIVHLGMSGSLRILSEELPAEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTRTL
EGHPVLAHLGPEPLSDAFNADYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFSAG
IHPDRLASSLSREECEQLVKVIKLVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRICGTPVVGTKHAQRATFYCRQCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccagaggttgaaaccagccgccgcggcatcgagccgcacctggttggc
gcaaccattctgcacgccgtcgtgcgcaacggacggctgcgctggccggtttccgaagag
atctatcgcctgagcgacgttccggttctcagcgtgcgtcgccgcgccaaatacctgctt
ctggagctgccggacggctggatcatcgtccatcttgggatgtcggggagcctgcgcatc
ctgagcgaagagctgcctgctgaaaaacacgatcacgttgacctggtcatgagtaacggc
aaggtgttgcgctacaccgatccacgccgctttggcgcctggttgtggaccagaacgctg
gaaggccatccggtactggcccatcttggcccggagccgctcagcgacgcgttcaacgcc
gactatctccagcaaaaatgcgcgaagaagaaaaccgcaatcaaaccctggctgatggat
aacaagctggtggtgggcgtggggaatatctacgccagtgaatcgctgttctccgccggg
atccatcctgaccggctggcgtcctcgctgtcgcgggaagagtgtgagcagctggtgaag
gtgattaagctggtcctgctgcgttcgatagagcagggcggcaccacgttaaaggatttc
ctgcaaagcgatggcaagccgggctatttcgcccaggagctacaggtctatggccgcaag
ggcgaaccctgccggatctgcggcacgccggtcgtcgggaccaaacatgcccagcgggcg
accttttattgccgtcagtgccagaagtag

DBGET integrated database retrieval system