KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_0186Help
Entry
A79E_0186         CDS       T02213                                 

Definition
Xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A79E_0186
   00051 Fructose and mannose metabolism
    A79E_0186
Enzymes [BR:kpp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     A79E_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
191760..193082
Genome map
AA seq 440 aa AA seqDB search
MQTYFDQLDRVRYEGPKSTNPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNGADMF
GVGSFDRPWQQPGDALEMAKRKADVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYSNNFA
RMVEVLAEKQQQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMNATHQL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQLVVEHKHKIGFKGTLLIEPKPQEPTK
HQYDYDASTVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVDANRG
DPQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALSLKVAARMIEDGELDKRVARRYAGWNGELGQQILNGQMTLSDIAQYAAQHQLAPQ
HRSGQQEQLENLVNHYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcagacctatttcgatcaactcgatcgcgttcgttacgaaggcccgaaatccactaac
ccgctggctttccgtcattacaacccggatgaactggtgctgggcaaacggatggaagat
catctgcgttttgcggcctgttactggcacaccttctgctggaatggcgccgatatgttt
ggcgtgggctcctttgatcgtccctggcagcagcctggcgacgccctggagatggccaaa
cgcaaagccgatgtggcgttcgaattcttccataaactcaacgtgccttactactgcttc
cacgacgttgacgtctcgccggaaggcgcttccctcaaggagtacagcaataacttcgcc
cggatggtcgaggtgctggctgagaaacagcagcagagcggcgtgaagcttctgtggggg
accgcaaactgctttaccaacccgcgctacggcgccggcgcggccaccaacccggatccg
gaagtatttagctgggcggccacccaggtggtcaccgccatgaatgccacccatcaactg
ggcggtgaaaactatgtgctgtggggcggtcgcgagggctatgaaaccctgctgaatacc
gacctgcgccaggagcgtgagcagattggccgctttatgcagctggtggtggagcataag
cataaaatcggctttaaaggtacgctgctgattgagcccaaaccgcaggagccgaccaag
catcagtatgactatgatgcctctaccgtttacggcttcctcaaacagtttggtctggaa
aaagagattaaactgaatattgaagctaaccatgccacgctcgccggccattcgttccat
catgaaattgcgacggccattgcgctggggctgttcggctccgttgacgccaaccgcggc
gatccgcagctgggctgggataccgaccagttcccgaacagcgtcgaagagaacgcgctg
gtgatgtatgaaatcctcaaagcgggcggcttcaccaccggcggcctcaactttgatgcg
aaagtgcgccggcagagcaccgacaaatacgatctgttctatggtcatattggcgcgatg
gataccatggcgctgtcgctgaaggtcgcggcgcggatgatcgaggacggcgaactggat
aagcgcgtggccagacgctacgccggctggaacggtgagctggggcagcagatccttaac
gggcagatgaccctgagcgatattgcccagtatgccgctcagcatcagctggcgccgcag
catcgcagcggccagcaggaacaactggaaaacctggtcaaccattatctgtttgacaag
taa

DBGET integrated database retrieval system