KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_0227Help
Entry
A79E_0227         CDS       T02213                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A79E_0227
Enzymes [BR:kpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     A79E_0227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
240530..241531
Genome map
AA seq 333 aa AA seqDB search
MPLRALVAVIVTTVVMLVPRAWADTAWERYKARFMMPDGRIIDTANGNVSHTEGQGFAML
LAVANNDRPAFDKLWQWTDNTLRNKSNGLFYWRYNPVAPDPIADKNNASDGDTLIAWALL
RAQKQWQDKRYAIASDAITAALLKSTVVTFAGRQVMLPGVKGFNLNDHLNLNPSYFIFPA
WRAFAERTHLTAWRTLQSDGQALLGQMGWGKSHLPSDWVALRADGKMLPAKEWPPRMSFD
AIRIPLYLSWADPHSALLAPWKAWMQSYPRLQTPAWINVSTNEVAPWYMAGGLLAVRDLT
LGEPQEAPQIDDKDDYYSASLKLLVWLAKQDQR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcgtgctttagtggcggtgatagtgacaacggtagtgatgctggtgcccagg
gcgtgggcggatacggcctgggagcgctataaggcccgttttatgatgccggatggtcgt
atcattgataccgccaatggcaatgtgtcgcatacggaaggtcagggcttcgccatgctc
ctggcggtggcgaataacgatcgtccggcgttcgacaagctgtggcagtggacggacaac
accctgcgcaacaagtctaacgggttgttttactggcgctataacccggtggcgccggac
cctatcgccgataaaaacaacgcctccgatggcgataccctgatcgcctgggcgctgctg
cgcgcgcaaaagcagtggcaggataagcgctatgcgattgcctctgacgccatcaccgcc
gccctgctgaagtctacggtggtgactttcgccggtcgccaggtaatgctcccgggtgtg
aaagggttcaacctcaatgatcacctgaaccttaacccttcctatttcatcttcccggcc
tggcgcgccttcgcggagcggacgcatctcaccgcctggcggacattgcagagcgacgga
caggcgctgctggggcagatgggctgggggaaatcacatctacccagcgactgggtggcg
ctgcgggcggatggcaagatgctgccagccaaagagtggccgccgcggatgagtttcgat
gcgatccgtatcccgctgtatctctcgtgggccgatccgcacagcgccttgctcgcgccc
tggaaggcctggatgcagagttacccgcgcctgcaaaccccggcgtggatcaacgtcagc
accaacgaggtggctccctggtatatggccggcggcctgctggcggtgcgcgatctgacg
ctgggtgaaccgcaggaggcgccgcagattgacgacaaggatgattattactctgccagc
ctcaagctgttggtctggctggcgaaacaggatcagcgctaa

DBGET integrated database retrieval system