KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_0234Help
Entry
A79E_0234         CDS       T02213                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kpp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
251139..252248
Genome map
AA seq 369 aa AA seqDB search
MMKVLCGAVLSALLLAAGQVGAACQWPAWEQFKQAYVSPEGRVIDPSDARKISTSEGQSY
GLFFALAANDRAGFDKLLTWTQNNLAEGDLKQHLPGWLWGKKDDEQWTLLDSNSASDSDL
WIAWALLEAGRLWQQPQYTETGKALLARIVAEETVAVPGLGTMLLPGKVGFADDSGWRFN
PSYLPPQLATYFVRFGAPWPALRDSNLRLLLETAPKGFTPDWVRYEKGKGWQLKTEKPPI
GSYDAIRVYLWVGMLHDGDKQKARLLQRFAPMAAQTTKQGVPPEKVNIATGKTSGQGPVG
FSAAMLPFLQDDEARSVQRQRVADNYPGADAYYSAVLTLFGQGWDQHRFRFTASGELQPD
WNQECASSH
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagtactttgtggcgcggtgctctcggcgctgctgctggcggcgggccaggtg
ggcgccgcctgccagtggcccgcctgggagcagtttaaacaagcgtacgtcagccccgag
ggacgggtgattgaccccagcgatgcgcgcaaaatctccacctcggaaggacagagctat
ggcctgtttttcgccctggcggccaacgatcgcgcagggttcgacaaactgctgacctgg
acgcagaacaacctggcggaaggcgatctgaaacaacatttgccgggctggctgtggggc
aaaaaggacgatgagcagtggaccctgctggacagcaactcggcgtccgactcggatctg
tggatagcctgggcgctgctggaggcggggcgcctgtggcaacagccgcagtacaccgag
accggtaaagccctgctggcgcggattgtcgctgaagagacggtggcggtgccgggcctc
ggcacgatgctgctgccgggaaaagtcggttttgccgatgacagcggctggcggtttaac
cccagctatcttccgccgcagctggccacctactttgtgcgttttggcgcgccgtggccc
gctctgcgcgatagtaacctgcgcctgctgctggagaccgcgccgaaaggctttaccccg
gactgggtgcgctatgagaaagggaaaggctggcagctgaaaaccgaaaagccgccgatc
ggcagctatgacgcgattcgcgtctacctgtgggtgggcatgctccatgatggcgataag
cagaaagcgcgtctgttgcaacgcttcgcgccgatggcggcgcagaccacgaagcagggg
gtacccccggagaaagtgaatatcgccaccggcaaaaccagcggccaggggccagtgggc
ttctccgcggcaatgctgccgtttttacaggacgacgaggcccggtcggtgcaacgccag
cgcgtcgccgataactatcccggcgcggatgcctactacagcgcagttctgacgctgttc
ggccagggttgggatcaacaccgttttcgtttcacggcgagtggtgaattacaacctgac
tggaaccaggaatgcgcaagctctcactaa

DBGET integrated database retrieval system