KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_0327Help
Entry
A79E_0327         CDS       T02213                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A79E_0327
Enzymes [BR:kpp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     A79E_0327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
363181..365274
Genome map
AA seq 697 aa AA seqDB search
MESKRLDNAALAAGISPSYINAHGKPQSIAAVTKQRLLDAMHRSTAATKVAVNPLPNVKI
FTHGKKMSLPVAGRGEYQWILTTEDGKQYQGKTRGGETLPLPAKLPEGYHSLTLTQEGER
WHCRTIVAPARCYEPQPLKEGKKLWGTCVQLYTLRSEKNWGIGDFGDLRAMLPEIARRGG
SFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFQRSEEAQAWWQSPATQQ
ALQAARETDDVDYTAVTTLKMTALRMAWKQFSRREDEQMTAFREFVLREGESLYWQAAFD
ALHAWQVQQDPLRWGWPAWPKAFQDIDSPEVKAFCVEHEDDVSFYLWLQWLAWSQFAACW
ETSQRDGMPIGLYRDLAVGVAEGGSETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMD
PHIIAARAYEPFIDLLRANMQNCGALRIDHVMSVLRLWWIPYGETADHGAYVQYPVDDLL
SLLALESQRHRCMVIGEDLGTVPVEIVSKLRNSGVYSYKVLYFESDAEKTFRAPALYPEQ
SMAVATTHDLPTLRGYWESGDLTLGKALGLYPDEVVLRGLYQDRELAKQGLLDALHKYGC
LPKRAGHKASLMSMTGILNRGMQRYIADSNSALLGLQPEDWLEMATPVNIPGTSTEYPNW
RRKLSVTLEQMFADERVNKLIKDLDKRRKAASKKAAS
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggagagtaaacgcctcgataatgccgcgctggcggcgggcatcagccccagctatatc
aacgcgcacggcaagccgcagtctatcgcggctgtcaccaaacagcgcctgctggatgcg
atgcatcgctctaccgccgccacgaaagtggcggttaacccgctgccgaacgtgaaaatt
ttcactcacggcaaaaaaatgtcgctgccggtggcaggacgcggtgagtatcagtggatc
ctgactactgaggacggtaagcagtatcaagggaaaacccgcggcggcgagacgctgccg
ctgccggccaaactgccggaggggtaccactccctgaccctcacccaggagggggagcgc
tggcactgccggactatcgtcgcgccagcccgctgctatgagccgcagccgctgaaagag
gggaaaaagctgtggggcacctgcgtgcagctgtataccctgcgctcagagaaaaactgg
gggatcggcgattttggcgatctgcgggccatgctgccggaaatcgcccgccgcggcggg
tcgtttattggccttaacccgattcatgccctctatccggcgaacccggagagcgccagc
ccctatagcccgtcttcacgtcgctggctgaacgttatttatatcgacgtcaacgcggtt
gaagatttccagcgtagcgaagaggcgcaggcgtggtggcagtctccggcaacgcagcag
gcactgcaggcggcgcgggaaacggacgatgtggattataccgccgtcactacgctgaaa
atgaccgcgctgcgtatggcatggaaacaattctctcgtcgtgaagatgagcagatgaca
gcgttccgcgagtttgttctgcgcgaaggggaaagcctctactggcaggcggctttcgat
gcgctgcacgcctggcaggtacaacaggacccgctgcgctggggctggccggcctggccg
aaggcctttcaggatatcgacagcccggaggtgaaagccttctgcgttgagcatgaggat
gacgtcagtttctatctttggctgcagtggctggcctggagtcagtttgctgcctgctgg
gaaaccagccagcgtgacggcatgccgatcggcctctaccgcgacctggcggtgggcgtc
gccgagggcgggtcggaaacctggtgcgatcgtgaactgtactgcctgaaagcatccgta
ggcgcgccgccggatattctgggcccgctgggccagaactggggcctgccgccgatggat
ccgcatatcattgccgcccgcgcctatgagccgtttatcgacctgctgcgcgctaatatg
cagaactgcggcgcgttgcgcatcgatcacgtgatgtctgtgctgcgtctgtggtggatc
ccgtatggtgaaaccgccgaccatggcgcttacgttcagtatccggtcgacgatctgctg
tcgcttctggcgctggaaagccagcgtcatcgctgcatggtgatcggtgaagatctgggc
acggtaccggtggagatcgtcagcaagttacgcaacagcggcgtctattcttataaggtg
ctctattttgagagtgatgcagagaaaacgttccgcgcgccggcgctgtacccggagcaa
tcaatggctgtggcgacgacgcacgacctgcccactctccgcggctactgggaaagcggc
gatctgacgttaggtaaagcgctgggcctctatcctgatgaggtggtgctgcgcggactg
taccaggaccgcgagctggcgaaacaagggctgctggacgcgctgcataagtacggctgt
ctgcccaagcgcgccggccataaggcctcgctgatgagcatgacggggatcctcaaccgg
gggatgcagcgttatattgccgacagcaacagcgccctgctgggcctgcagccggaagac
tggctggagatggcgacgccggttaacattccgggcaccagcaccgagtacccgaactgg
cgccggaagctgtccgtcaccctggagcagatgtttgccgatgaacgggtcaataagctg
attaaggatctggataaacggcgcaaggcggcgagcaagaaagccgcctcctga

DBGET integrated database retrieval system