KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_0746Help
Entry
A79E_0746         CDS       T02213                                 

Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:kpp00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
765133..766053
Genome map
AA seq 306 aa AA seqDB search
MSTLGHQYDNSLVSNAFGFLRLPMNFMPYESDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPNEGLIDPNH
SVQIGIRTEFDKDNGFTVLDAGQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKKGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttaggtcatcaatacgataactctctggtatccaatgcctttggctttctg
cgtttgccgatgaactttatgccgtatgaaagcgatgcggactgggtcatcaccggcgtg
ccgttcgatatggcgacctccgggcgcgcgggcggccgtcatggcccggcggcgatccgt
caggtttccactaaccttgcctgggagcacaaccgtttcccgtggaacttcgatatgcgc
gagcgcctgaacgtggtggactgcggggatctggtgtacgccttcggcgacgcgcgcgaa
atgagcgagaagctgcaggctcacgccgagaagctgctggcggccggcaaacgtatgctc
tcctttggcggcgaccacttcgttaccctgccgctgctgcgcgcccatgccaagcacttt
ggtaaaatggcgttggtgcacttcgatgctcacaccgatacctacgccaacggctgcgag
ttcgaccacggcaccatgttctataccgcgccgaacgaagggcttatcgatccgaaccac
tccgtacagatcgggatccgcaccgaattcgacaaagacaatggctttacggtgctcgac
gccggccaggttaacgaccgcagcgttgatgacgtgattgcccaggtgaagcagatcgtc
ggcgacatgccggtgtacctgacctttgatatcgactgtctggatccggcgtttgcgcca
ggcaccggtaccccggttatcggtgggctgacctccgaccgcgcgatcaagctggtgcgc
ggcctgaaggacctgaacatcgtcgggatggacgtggtggaagtcgccccggcctacgat
cagtccgaaattaccgctctggcggcggcgaccctggcgctggagatgctgtacatccag
gcggcgaaaaagggcgaataa

DBGET integrated database retrieval system