KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_0784Help
Entry
A79E_0784         CDS       T02213                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Brite
Enzymes [BR:kpp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     A79E_0784
Secretion system [BR:kpp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   A79E_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
801690..802403
Genome map
AA seq 237 aa AA seqDB search
MKKGLLMFTLLAASLSGAAHADSAAIKQSLAKLGVQSTDIQPSPVSGMSTVLTDSGVLYV
TDDGKHIIQGPMYDVSGAQPVNVTNQLLLGKLNALSNEMIVYKAPKEQHVITVFTDITCG
YCHKLHEQMSDYNALGITVRYLAFPRQGLQSQAEQDMKAIWCAKDRNKALDDAMNGKGVQ
PASCSVDIAKHYTLGVQMGVNGTPAMVLSNGMVLPGYQGPKELKAFLDEHKKQTSGN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttattgatgttcaccctgctggcggcctccctttcaggagcggcgcac
gccgatagcgcggcaattaaacagtcgctggcgaagctgggtgtgcagagcaccgatatt
caaccatcgccggtttccgggatgagcacggtgctgaccgacagcggcgtgctgtacgtg
accgacgacggcaaacatatcatccaggggccgatgtacgacgtgagcggcgcgcagccg
gtcaacgtcaccaaccagctgctgctgggtaagctgaacgcgctgagcaatgagatgatt
gtctacaaagcgccgaaggagcagcacgtcatcaccgtcttcaccgatattacctgcggc
tactgtcataaactgcacgagcagatgagcgactacaacgcgctggggatcaccgtgcgc
tatctggctttcccgcgccagggtctgcaaagccaggcggagcaggacatgaaggccatc
tggtgcgcgaaagatcgcaacaaagcgctggatgacgccatgaatggtaaaggcgtgcag
ccggcgagctgcagcgtagatatcgccaaacattacaccctcggcgtgcagatgggcgtc
aacggtacgccggcgatggtcctcagtaacggcatggtgctgccgggctatcaggggccg
aaagagctgaaggcgttccttgatgagcacaaaaaacagacaagcggtaactga

DBGET integrated database retrieval system